Basic Vector Information
- Vector Name:
- pPICZalphaH6E
- Antibiotic Resistance:
- Bleomycin
- Length:
- 3551 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Janakiraman VN, Cabanne C, Dieryck W, Hocquellet A, Joucla G, Le Senechal C, Chaignepain S, Costaglioli P, Santarelli X, Garbay B, Noubhani A.
- Promoter:
- AOX1
pPICZalphaH6E vector Map
pPICZalphaH6E vector Sequence
LOCUS 40924_34600 3551 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pPICZalphaH6E, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3551) AUTHORS Janakiraman VN, Cabanne C, Dieryck W, Hocquellet A, Joucla G, Le Senechal C, Chaignepain S, Costaglioli P, Santarelli X, Garbay B, Noubhani A. TITLE Production and purification of recombinant human hepcidin-25 with authentic N and C-termini JOURNAL J. Biotechnol. 195, 89-92 (2015) PUBMED 25562424 REFERENCE 2 (bases 1 to 3551) AUTHORS Dieryck W, Narasimhan Janakiraman V, Cabanne C, Hocquellet A, Joucla G, Le Senechal C, Chaignepain S, Costaglioli P, Santarelli X, Garbay B, Noubhani A. TITLE Direct Submission JOURNAL Submitted (19-JUN-2014) ENSTBB, Institut Polytechnique de Bordeaux, 146 rue Leo Saignat, Bordeaux, gironde 33076, France REFERENCE 3 (bases 1 to 3551) TITLE Direct Submission REFERENCE 4 (bases 1 to 3551) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Biotechnol. 195, 89-92 (2015)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-JUN-2014) ENSTBB, Institut Polytechnique de Bordeaux, 146 rue Leo Saignat, Bordeaux, gironde 33076, France" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3551 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 2..940 /label=AOX1 promoter /note="inducible promoter, regulated by methanol" CDS 941..1207 /codon_start=1 /label=alpha-factor secretion signal /note="N-terminal secretion signal from S. cerevisiae alpha-factor" /translation="MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLE GDFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEA" CDS 1238..1255 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 1301..1315 /codon_start=1 /label=enterokinase site /note="enterokinase recognition and cleavage site" /translation="DDDDK" misc_feature 1315..1359 /label=multiple cloning site /note="multiple cloning site" terminator 1375..1621 /label=AOX1 terminator /note="transcription terminator for AOX1" promoter 1636..2047 /label=TEF1 promoter /note="promoter for EF-1-alpha" promoter 2055..2102 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 2121..2492 /codon_start=1 /label=BleoR /note="antibiotic-binding protein" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" terminator 2561..2808 /label=CYC1 terminator /note="transcription terminator for CYC1" rep_origin complement(2883..3471) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.