pPh110 vector (V004116)

LOCUS       40924_34416        4263 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPh110, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4263)
  AUTHORS   Krom RJ, Bhargava P, Lobritz MA, Collins JJ.
  TITLE     Engineered Phagemids for Nonlytic, Targeted Antibacterial Therapies
  JOURNAL   Nano Lett. 15 (7), 4808-4813 (2015)
  PUBMED    26044909
REFERENCE   2  (bases 1 to 4263)
  AUTHORS   Krom RJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2015) Molecular Medicine, Boston University, 72 
            East Concord St, Boston, MA 02118, USA
REFERENCE   3  (bases 1 to 4263)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4263)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nano 
            Lett."; date: "2015"; volume: "15"; issue: "7"; pages: "4808-4813"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-JUN-2015) Molecular Medicine, Boston University, 72 East Concord
            St, Boston, MA 02118, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4263
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        31..104
                     /label=PLtetO-1 promoter
                     /note="modified phage lambda PL promoter with tet operator
                     sites (Lutz and Bujard, 1997)"
     CDS             142..264
                     /codon_start=1
                     /product="cecropin PR-39"
                     /label=cecropin PR-39
                     /protein_id="AKQ98654.1"
                     /translation="MRRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP"
     CDS             313..435
                     /codon_start=1
                     /product="cecropin PR-39"
                     /label=cecropin PR-39
                     /protein_id="AKQ98655.1"
                     /translation="MRRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP"
     terminator      456..550
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     regulatory      631..704
                     /label=PLtet0
                     /note="PLtet0"
                     /regulatory_class="promoter"
     promoter        631..704
                     /label=PLtetO-1 promoter
                     /note="modified phage lambda PL promoter with tet operator
                     sites (Lutz and Bujard, 1997)"
     protein_bind    631..649
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    656..674
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     RBS             730..738
                     /label=Shine-Dalgarno sequence
                     /note="full consensus sequence for ribosome-binding sites 
                     upstream of start codons in E. coli; complementary to a 
                     region in the 3' end of the 16S rRNA (Chen et al., 1994)"
     CDS             745..804
                     /codon_start=1
                     /product="apidaecin"
                     /label=apidaecin
                     /protein_id="AKQ98656.1"
                     /translation="MGNNRPVYIPQPRPPHPRI"
     RBS             843..851
                     /label=Shine-Dalgarno sequence
                     /note="full consensus sequence for ribosome-binding sites 
                     upstream of start codons in E. coli; complementary to a 
                     region in the 3' end of the 16S rRNA (Chen et al., 1994)"
     CDS             857..916
                     /codon_start=1
                     /product="apidaecin"
                     /label=apidaecin
                     /protein_id="AKQ98657.1"
                     /translation="MGNNRPVYIPQPRPPHPRI"
     regulatory      923..1045
                     /label=T0
                     /note="T0"
                     /regulatory_class="terminator"
     terminator      937..1031
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     regulatory      1064..1137
                     /label=PLtet0
                     /note="PLtet0"
                     /regulatory_class="promoter"
     promoter        1064..1137
                     /label=PLtetO-1 promoter
                     /note="modified phage lambda PL promoter with tet operator
                     sites (Lutz and Bujard, 1997)"
     protein_bind    1064..1082
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    1089..1107
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     CDS             1175..1384
                     /codon_start=1
                     /product="YeeV'"
                     /label=YeeV'
                     /protein_id="AKQ98658.1"
                     /translation="MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFAD
                     ERVIEQHIEAGISLCDAVNFLVEK"
     CDS             1437..1646
                     /codon_start=1
                     /product="YeeV'"
                     /label=YeeV'
                     /protein_id="AKQ98659.1"
                     /translation="MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFAD
                     ERVIEQHIEAGISLCDAVNFLVEK"
     regulatory      1653..1775
                     /label=T0
                     /note="T0"
                     /regulatory_class="terminator"
     terminator      1667..1761
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     rep_origin      1830..2257
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     terminator      2282..2368
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     rep_origin      complement(2532..3120)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     terminator      complement(3208..3302)
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     CDS             complement(3336..4127)
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"