Basic Vector Information
- Vector Name:
- pPAL
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3407 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Kobayashi H.
pPAL vector Map
pPAL vector Sequence
LOCUS 40924_34056 3407 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pPAL DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3407) AUTHORS Kobayashi H. TITLE Inducible suppression of global translation by overuse of rare codons JOURNAL Appl. Environ. Microbiol. 81 (7), 2544-2553 (2015) PUBMED 25636849 REFERENCE 2 (bases 1 to 3407) AUTHORS Kobayashi H. TITLE Direct Submission JOURNAL Submitted (07-JAN-2015) Contact:Hideki Kobayashi Agency for Marine-Earth Science and Technology, Institute of Biogeosciences; 2-15 Natsushima, Yokosuka, Kanagawa 237-0061, Japan URL :http://www.jamstec.go.jp/j/ REFERENCE 3 (bases 1 to 3407) TITLE Direct Submission REFERENCE 4 (bases 1 to 3407) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2015"; volume: "81"; issue: "7"; pages: "2544-2553" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (07-JAN-2015) Contact:Hideki Kobayashi Agency for Marine-Earth Science and Technology, Institute of Biogeosciences; 2-15 Natsushima, Yokosuka, Kanagawa 237-0061, Japan URL :http://www.jamstec.go.jp/j/" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3407 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 200..913 /codon_start=1 /label=yeGFP /note="yeast-enhanced green fluorescent protein" /translation="MSKGEELFTGVVPILVELDGDVNGQKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFYKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMADKPKNGIKV NFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLE FVTAAGITHGMDELYK" terminator 1127..1213 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 1305..1332 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 1352..1443 /label=AmpR promoter CDS 1444..2301 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPTAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" terminator 2334..2428 /label=lambda t0 terminator /note="transcription terminator from phage lambda" rep_origin 2516..3104 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(3268..3354) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.