Basic Vector Information
- Vector Name:
- pFRT2-lux-Tel
- Length:
- 11266 bp
- Type:
- Fusion vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Kang Y, Norris MH, Barrett AR, Wilcox BA, Hoang TT.
- Promoter:
- Pc
pFRT2-lux-Tel vector Map
pFRT2-lux-Tel vector Sequence
LOCUS 40924_20536 11266 bp DNA circular SYN 18-DEC-2018 DEFINITION Fusion vector pFRT2-lux-Tel, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11266) AUTHORS Kang Y, Norris MH, Barrett AR, Wilcox BA, Hoang TT. TITLE Engineering of tellurite-resistant genetic tools for single-copy chromosomal analysis of Burkholderia spp. and characterization of the Burkholderia thailandensis betBA operon JOURNAL Appl. Environ. Microbiol. 75 (12), 4015-4027 (2009) PUBMED 19376905 REFERENCE 2 (bases 1 to 11266) AUTHORS Kang Y, Norris MH, Barrett AR, Videau PJA., Wilcox BA, Hoang TT. TITLE Genetic Systems for Single Copy Analysis based on a Non-antibiotic Selectable Marker in Burkholderia spp. JOURNAL Unpublished REFERENCE 3 (bases 1 to 11266) AUTHORS Kang Y, Norris MH, Barrett AR, Videau PJA., Wilcox BA, Hoang TT. TITLE Direct Submission JOURNAL Submitted (11-NOV-2008) Microbiology, University of Hawaii at Manoa, 2538 McCarthy Mall, Snyder Hall 207, Honolulu, HI 96822, USA REFERENCE 4 (bases 1 to 11266) TITLE Direct Submission REFERENCE 5 (bases 1 to 11266) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2009"; volume: "75"; issue: "12"; pages: "4015-4027" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (11-NOV-2008) Microbiology, University of Hawaii at Manoa, 2538 McCarthy Mall, Snyder Hall 207, Honolulu, HI 96822, USA" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..11266 /mol_type="other DNA" /organism="synthetic DNA construct" oriT complement(190..299) /direction=LEFT /label=oriT /note="incP origin of transfer" terminator complement(720..747) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(839..925) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" CDS complement(1549..2658) /label=LuxE /note="LuxE" CDS complement(2840..3820) /label=LuxB /note="LuxB luciferase subunit" CDS complement(3838..4917) /label=LuxA /note="LuxA luciferase subunit" CDS complement(4969..5889) /label=LuxD /note="LuxD acyltransferase" CDS complement(5904..7343) /label=LuxC /note="LuxC fatty acid reductase" protein_bind complement(7408..7455) /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." promoter 7558..7586 /label=Pc promoter /note="class 1 integron promoter" terminator 7710..7741 /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" CDS complement(7759..8712) /codon_start=1 /gene="telB" /product="TelB" /label=telB /note="tellurite resistance" /protein_id="ACJ70732.1" /translation="MNATNTDVFAQVGGLEARGAKMKKRGTRFLIAALAVLAIAGIGAV TGWAISPSATPGSIDVPQVLASTFSDQVPGSEGGGLGGGLPFTSAVGAFTDFMAGPAIF TLGILGIVVAGAVLVFGGEFCGFVRSVCMMVIAVSMIFVSSNLVKGILGGDHDAGPAEP SPRARFMAAVEAKDFARVQELIEARGAKSAADYVLAQLAVAEGLDRKPGARVVVGKAAG SMAMPPAALGFTPRGEAAYAIERSAYGEPRSSIAKQYQQEWNRKAATWWAMAGVAGIIG AILAAAATGFVGLAVSIRNRVKRVRDLLVMEPGAEP" gene complement(7759..8712) /gene="telB" /label=telB CDS complement(8709..9845) /codon_start=1 /gene="telA" /product="TelA" /label=telA /note="tellurite resistance" /protein_id="ACJ70733.1" /translation="MNALKTTHDAKAPIVAFDMTPATLRELGLQESDVPEVHAVAQRIE VGSPQTVAEFGRDVAEHTSRYADSLLDQVRNSDLDEAGEKLTQVVAKARSLNVGPLSDN RSRLPLIGPLIDRFRVRSTGFMARFDTTREQIEHLVSEVQTTQQGIAQRNASLDEMFAA VREEHRLLGVHIAAGKVRLAELREQAEGLRGNVGNDPGRVQELADLDAMVANLDKRIGD LIALQHSAMQSLPTIRMIQANNQMLVDKFHTIREITVPAWKRQFMLALSLNEQKNAVEL ATAIDDTTNDLMKRNAALLHRTSVETAKENQRLVIDVDTLKQVQTTLIKTVEDVIRIQQ EGVQKRKDAEKQIAAMRGDLQAKLTRQPVRELAQQESV" gene complement(8709..9845) /gene="telA" /label=telA CDS complement(9863..10636) /codon_start=1 /gene="kilA" /product="KilA" /label=kilA /note="tellurite resistance" /protein_id="ACJ70734.1" /translation="MEEQSVNMARLKGEVLPALFASPATIGEYGAGIDGADSLNELSNL MEHGAVAALADKISQIVAKLADADPRKIAEKPTWFEKMLGREVERQVRYQVARKTLDQL LDEAEGVAQRVRDTLRALDDMLNTHEAEVDRLRAYIQAGREFLDENPEAGAAKAGVIEF DKPRERFARKLANLATLMASHEMSVTQMKLTRAQAVDMLDRFSETASVLVPVWRQHTLA LITTKNMNPAMVAEAAKAHQALMRSLSQSLEGINQ" gene complement(9863..10636) /gene="kilA" /label=kilA RBS complement(10643..10665) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" regulatory 10676..10717 /note="derived from Burkholderia cenocepacia rpsL promoter" /regulatory_class="promoter" rep_origin 10857..11242 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication"
This page is informational only.