Basic Vector Information
- Vector Name:
- pFRT1-gfp-Tel
- Length:
- 6169 bp
- Type:
- Fusion vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Kang Y, Norris MH, Barrett AR, Wilcox BA, Hoang TT.
- Promoter:
- Pc
pFRT1-gfp-Tel vector Map
pFRT1-gfp-Tel vector Sequence
LOCUS 40924_20511 6169 bp DNA circular SYN 18-DEC-2018 DEFINITION Fusion vector pFRT1-gfp-Tel, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6169) AUTHORS Kang Y, Norris MH, Barrett AR, Wilcox BA, Hoang TT. TITLE Engineering of tellurite-resistant genetic tools for single-copy chromosomal analysis of Burkholderia spp. and characterization of the Burkholderia thailandensis betBA operon JOURNAL Appl. Environ. Microbiol. 75 (12), 4015-4027 (2009) PUBMED 19376905 REFERENCE 2 (bases 1 to 6169) AUTHORS Kang Y, Norris MH, Barrett AR, Videau PJA., Wilcox BA, Hoang TT. TITLE Genetic Systems for Single Copy Analysis based on a Non-antibiotic Selectable Marker in Burkholderia spp. JOURNAL Unpublished REFERENCE 3 (bases 1 to 6169) AUTHORS Kang Y, Norris MH, Barrett AR, Videau PJA., Wilcox BA, Hoang TT. TITLE Direct Submission JOURNAL Submitted (11-NOV-2008) Microbiology, University of Hawaii at Manoa, 2538 McCarthy Mall, Snyder Hall 207, Honolulu, HI 96822, USA REFERENCE 4 (bases 1 to 6169) TITLE Direct Submission REFERENCE 5 (bases 1 to 6169) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2009"; volume: "75"; issue: "12"; pages: "4015-4027" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (11-NOV-2008) Microbiology, University of Hawaii at Manoa, 2538 McCarthy Mall, Snyder Hall 207, Honolulu, HI 96822, USA" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..6169 /mol_type="other DNA" /organism="synthetic DNA construct" oriT complement(190..299) /direction=LEFT /label=oriT /note="incP origin of transfer" terminator complement(720..747) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(839..925) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" CDS complement(1528..2241) /label=GFP /note="green fluorescent protein" protein_bind 2303..2350 /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." promoter 2461..2489 /label=Pc promoter /note="class 1 integron promoter" terminator 2613..2644 /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" CDS complement(2662..3615) /codon_start=1 /gene="telB" /product="TelB" /label=telB /note="tellurite resistance" /protein_id="ACJ70712.1" /translation="MNATNTDVFAQVGGLEARGAKMKKRGTRFLIAALAVLAIAGIGAV TGWAISPSATPGSIDVPQVLASTFSDQVPGSEGGGLGGGLPFTSAVGAFTDFMAGPAIF TLGILGIVVAGAVLVFGGEFCGFVRSVCMMVIAVSMIFVSSNLVKGILGGDHDAGPAEP SPRARFMAAVEAKDFARVQELIEARGAKSAADYVLAQLAVAEGLDRKPGARVVVGKAAG SMAMPPAALGFTPRGEAAYAIERSAYGEPRSSIAKQYQQEWNRKAATWWAMAGVAGIIG AILAAAATGFVGLAVSIRNRVKRVRDLLVMEPGAEP" gene complement(2662..3615) /gene="telB" /label=telB CDS complement(3612..4748) /codon_start=1 /gene="telA" /product="TelA" /label=telA /note="tellurite resistance" /protein_id="ACJ70713.1" /translation="MNALKTTHDAKAPIVAFDMTPATLRELGLQESDVPEVHAVAQRIE VGSPQTVAEFGRDVAEHTSRYADSLLDQVRNSDLDEAGEKLTQVVAKARSLNVGPLSDN RSRLPLIGPLIDRFRVRSTGFMARFDTTREQIEHLVSEVQTTQQGIAQRNASLDEMFAA VREEHRLLGVHIAAGKVRLAELREQAEGLRGNVGNDPGRVQELADLDAMVANLDKRIGD LIALQHSAMQSLPTIRMIQANNQMLVDKFHTIREITVPAWKRQFMLALSLNEQKNAVEL ATAIDDTTNDLMKRNAALLHRTSVETAKENQRLVIDVDTLKQVQTTLIKTVEDVIRIQQ EGVQKRKDAEKQIAAMRGDLQAKLTRQPVRELAQQESV" gene complement(3612..4748) /gene="telA" /label=telA CDS complement(4766..5539) /codon_start=1 /gene="kilA" /product="KilA" /label=kilA /note="tellurite resistance" /protein_id="ACJ70714.1" /translation="MEEQSVNMARLKGEVLPALFASPATIGEYGAGIDGADSLNELSNL MEHGAVAALADKISQIVAKLADADPRKIAEKPTWFEKMLGREVERQVRYQVARKTLDQL LDEAEGVAQRVRDTLRALDDMLNTHEAEVDRLRAYIQAGREFLDENPEAGAAKAGVIEF DKPRERFARKLANLATLMASHEMSVTQMKLTRAQAVDMLDRFSETASVLVPVWRQHTLA LITTKNMNPAMVAEAAKAHQALMRSLSQSLEGINQ" gene complement(4766..5539) /gene="kilA" /label=kilA RBS complement(5546..5568) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" regulatory complement(5579..5620) /note="derived from Burkholderia cenocepacia rpsL promoter" /regulatory_class="promoter" rep_origin 5760..6145 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication"
This page is informational only.