pFGLAHIL6T vector (V006264)

LOCUS       40924_20011        7338 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Fungal expression vector pFGLAHIL6T, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7338)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7338)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 7338)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7338)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 
            9052, BELGIUM"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7338
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     379..395
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      457..1565
                     /label=A. niger glaA promoter
                     /note="A. niger glaA promoter"
                     /regulatory_class="promoter"
     misc_feature    1566..1606
                     /label=5' UTR of A. niger glaA
                     /note="5' UTR of A. niger glaA"
     exon            1607..1820
                     /note="mutated exon 1 of A. niger glaA"
     intron          1821..1895
                     /note="intron 1 of A. niger glaA"
     exon            1896..2182
                     /note="exon 2 of A. niger glaA"
     intron          2183..2237
                     /note="intron 2 of A. niger glaA"
     exon            2238..2334
                     /note="exon 3 of A. niger glaA"
     intron          2335..2395
                     /note="intron 3 of A. niger glaA"
     exon            2396..3033
                     /note="exon 4 of A. niger glaA"
     intron          3034..3091
                     /note="intron 4 of A. niger glaA"
     exon            3092..3775
                     /note="exon 5 of A. niger glaA"
     CDS             3776..3790
                     /codon_start=1
                     /note="unnamed protein product; spMF"
                     /protein_id="SJL89047.1"
                     /translation="RMDKR"
     CDS             3791..4348
                     /codon_start=1
                     /note="unnamed protein product; hIL6"
                     /protein_id="SJL89048.1"
                     /translation="APVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETC
                     NKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQN
                     RFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMT
                     THLILRSFKEFLQSSLRALRQM"
     terminator      4530..5095
                     /label=trpC terminator
                     /note="transcription terminator from the Aspergillus
                     nidulans trpC gene"
     primer_bind     complement(5117..5133)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(5141..5157)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(5165..5195)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(5210..5231)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(5519..6107)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(6281..7138)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(7139..7243)
                     /label=AmpR promoter