Basic Vector Information
- Vector Name:
- pFF706
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 8509 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Farzadfard F, Lu TK.
pFF706 vector Vector Map
pFF706 vector Sequence
LOCUS V006281 8509 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V006281 VERSION V006281 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8509) AUTHORS Farzadfard F, Lu TK. TITLE Synthetic biology. Genomically encoded analog memory with precise in vivo DNA writing in living cell populations JOURNAL Science 346 (6211), 1256272 (2014) PUBMED 25395541 REFERENCE 2 (bases 1 to 8509) AUTHORS Farzadfard F, Lu T. TITLE Direct Submission JOURNAL Submitted (04-DEC-2014) Biological Engineering, MIT, 77 Massachusetts Avenue, NE47, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 8509) TITLE Direct Submission REFERENCE 4 (bases 1 to 8509) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Science"; date: "2014"; volume: "346"; issue: "6211"; pages: "1256272" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (04-DEC-2014) Biological Engineering, MIT, 77 Massachusetts Avenue, NE47, Cambridge, MA 02139, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8509 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(42..184) /label="bom" /note="basis of mobility region from pBR322" CDS complement(289..477) /label="rop" /note="Rop protein, which maintains plasmids at low copy number" CDS complement(1281..1895) /gene="fixJ" /label="Transcriptional regulatory protein FixJ" /note="Transcriptional regulatory protein FixJ from Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110). Accession#: P23221" CDS complement(1892..3034) /codon_start=1 /product="YF1" /label="YF1" /protein_id="AIZ09121.1" /translation="MASFQSFGIPGQLEVIKKALDHVRVGVVITDPALEDNPIVYVNQG FVQMTGYETEEILGKNCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWN ELNIDPMEIEDKTYFVGIQNDITEHQQTQARLQELQSELVHVSRLSAMGEMASALAHEL NQPLAAISNYMKGSRRLLAGSSDPNTPKVESALDRAAEQALRAGQIIRRLRDFVARGES EKRVESLSKLIEEAGALGLAGAREQNVQLRFSLDPGADLVLADRVQIQQVLVNLFRNAL EAMAQSQRRELVVTNTPAADDMIEVEVSDTGSGFQDDVIPNLFQTFFTTKDTGMGVGLS ISRSIIEAHGGRMWAESNASGGATFRFTLPAADEMIGGLA" promoter complement(3035..3112) /label="lacIq promoter" /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." regulatory 3407..3653 /label="FixK2 promoter" /note="FixK2 promoter" /regulatory_class="promoter" RBS 3660..3671 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" CDS 3678..4388 /label="lambda repressor" /note="phage lambda repressor" CDS 4389..4421 /label="ssrA tag (LVA)" /note="C-terminal peptide that mediates degradation in bacteria through the ClpXP and ClpAP proteases (McGinness et al., 2006)" terminator 4469..4540 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 4556..4583 /label="T7Te terminator" /note="phage T7 early transcription terminator" regulatory 4598..4646 /label="lambda pR promoter" /note="lambda pR promoter" /regulatory_class="promoter" misc_feature 4655..4736 /note="primer for the Ec86 RT; msr" misc_feature complement(4726..4856) /note="template for Ec86 RT; msd(kanR_ON)" CDS 4876..5835 /gene="ret" /label="Retron Ec86 reverse transcriptase" /note="Retron Ec86 reverse transcriptase from Escherichia coli. Accession#: P23070" CDS 5875..6657 /label="Beta" /note="single-stranded DNA binding recombinase in the lambda Red system" terminator 6678..6764 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" rep_origin complement(6928..7516) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(7604..7698) /label="lambda t0 terminator" /note="transcription terminator from phage lambda" CDS complement(7722..8378) /label="CmR" /note="chloramphenicol acetyltransferase" promoter complement(8379..8481) /label="cat promoter" /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase"
This page is informational only.