Basic Vector Information
- Vector Name:
- pFAR1-act1
- Length:
- 8702 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Cote P, Sulea T, Dignard D, Wu C, Whiteway M.
pFAR1-act1 vector Vector Map
pFAR1-act1 vector Sequence
LOCUS V006299 8702 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V006299 VERSION V006299 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8702) AUTHORS Cote P, Sulea T, Dignard D, Wu C, Whiteway M. TITLE Evolutionary reshaping of fungal mating pathway scaffold proteins JOURNAL MBio 2 (1), e00230-10 (2011) PUBMED 21249169 REFERENCE 2 (bases 1 to 8702) AUTHORS Cote P. TITLE Direct Submission JOURNAL Submitted (02-NOV-2010) Health Sector, CNRC-BRI, 6100 Royalmount Av., Montreal, QC H4P2R2, Canada REFERENCE 3 (bases 1 to 8702) TITLE Direct Submission REFERENCE 4 (bases 1 to 8702) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "MBio"; date: "2011"; volume: "2"; issue: "1"; pages: "e00230-10" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-NOV-2010) Health Sector, CNRC-BRI, 6100 Royalmount Av., Montreal, QC H4P2R2, Canada" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8702 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(3..458) /direction=LEFT /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 600..616 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 626..644 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" CDS 1124..1933 /gene="URA3" /label="Orotidine 5'-phosphate decarboxylase" /note="Orotidine 5'-phosphate decarboxylase from Candida albicans (strain SC5314 / ATCC MYA-2876). Accession#: P13649" primer_bind 2060..2076 /label="SK primer" /note="common sequencing primer, one of multiple similar variants" misc_feature complement(2189..2917) /note="RPS1 locus; cloning site" CDS complement(3086..5392) /codon_start=1 /product="FAR1" /label="FAR1" /note="Candida albicans FAR1" /protein_id="ADW40667.1" /translation="MRKLFHSPKKRTSTSTKLESILPFPAETKKYNNIKCSLCQELLSL TLPGELIVLLECGHMSHKNCLSLIQSVPVCSECNVMSNYDYPPFTPVDQIQSPAKLNTQ LETPSFTSSDQTIYNPRVTCTSEISEVTLTPPYEIAYVLNVQAPLIFNAHKPTLEDLQL KERVEEFLKVHLDTDKDVGQLVIFDILEVSVTGKSWDLALVCLFENYFLIYENELLVGI ISVQHDISSVDVDEELILNLAKDSLPELRLRHSNKLVVQKWGTLLLEIIDNESVVTNIY QLTNTYWTHLPPEICVPQNLTKLNNAILSGTTISNSDIARILPTPKQLLLNLILALPLV NQTSLTDLEYKTQIQQIFQKTLHELRPNDKLGVIFLGIDGSKKPCAKGSFVGCTEPSWS EWKQVIRDITIVPNSFQSNLQEINVAIEKCMELYPFIPRTTSSVNKFLILSPNTYSQLP KDAPKSKFIDAINEKLSCTIVCVGSTYGNYQPFKSITTFGTPFLRFESFAKFGSLLVYY INENLHKICIPKLTLTLKASQGFRFTDLDSRGAIDGSQLTLTIKDIVPQTQKLIVLKVQ ANPQFVASKYQTLPIFEYDGYWFYEKYLDTKLISTRVKIGVSQQPPTPIDAEARGSFTE YYLDIPLLPPVSPARDAVFAKRQTELTIINSLKKSIALGESQVSLDIIKSCISLAHGLI RTSLEGSTKSHTNESSPECEYSMLQLLMAVRYTDKGNVEYIDFLVNHMKSIAKLLESDL DAGKLRCSDLMNSLI" regulatory complement(5405..6428) /label="ACT1" /note="ACT1" /regulatory_class="promoter" promoter complement(6461..6479) /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(6500..6516) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(6524..6540) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(6548..6578) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(6593..6614) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(6902..7490) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(8209..8587) /label="ISS" /note="immunostimulatory sequence from the AmpR gene; contains unmethylated CpG dinucleotides in the context of 5'-AACGTT-3' (Sato et al., 1996)"
This page is informational only.