Basic Vector Information
- Vector Name:
- pFA-pHluorin-ARG4
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5412 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Epp E, Nazarova E, Douglas LM, Konopka JB, Vogel J, Whiteway M.
pFA-pHluorin-ARG4 vector Vector Map
pFA-pHluorin-ARG4 vector Sequence
LOCUS 40924_19121 5412 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pFA-pHluorin-ARG4, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5412) AUTHORS Epp E, Nazarova E, Douglas LM, Konopka JB, Vogel J, Whiteway M. TITLE Actin dynamics and endocytosis in the absence of Arp2/3 in Candida albicans JOURNAL Unpublished REFERENCE 2 (bases 1 to 5412) AUTHORS Epp E, Nazarova E, Douglas LM, Konopka JB, Vogel J, Whiteway M. TITLE Direct Submission JOURNAL Submitted (24-MAY-2011) Biology, McGill University, 1205 Docteur Penfield, Montreal, Quebec H3A 1B1, Canada REFERENCE 3 (bases 1 to 5412) TITLE Direct Submission REFERENCE 4 (bases 1 to 5412) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-MAY-2011) Biology, McGill University, 1205 Docteur Penfield, Montreal, Quebec H3A 1B1, Canada" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5412 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 55..765 /label=superecliptic pHluorin /note="pH-sensitive mutant of green fluorescent protein (Ng et al., 2002)" regulatory 771..1024 /label=Saccharomyces cerevisiae URA3 terminator /note="Saccharomyces cerevisiae URA3 terminator" /regulatory_class="terminator" CDS 1482..2888 /codon_start=1 /gene="ARG4" /product="Arg4" /label=ARG4 /protein_id="AEI30145.1" /translation="MSQQQDKQPSENKLWGGRFTGATDPLMDLYNASLPYDKVMYDADL TGTKVYTQGLNKLGLITTEELNLIHQGLEQIRQEWHDNKFIIKAGDEDIHTANERRLGE IIGKNISGKVHTGRSRNDQVATDMRIFVRESLLNLSKILHQFITAILERAHKEIDVLMP GYTHLQKAQPIRWAHWLSSYATYFTEDYKRLQEIITRVNQSPLGSGALAGHPYGIDREF LAKGLGFDGVIGNSLTAVSDRDFVVESLFWSTLFMNHISRFSEDLIIYSSGEFGFIKLA DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLSGFLMSIKSIPSTYNKDMQEDKEPLF DALTTVEHSILIATGVISTLLIDKQNMEKALTMDMLATDLADYLVRKGVPFRETHHISG ECVRKAEEEKLSGIDQLSFEQFQQIDSRFEKDVMETFDFEASVERRDALGGTAKSAVLK QLENLKSILS" gene 1482..2888 /gene="ARG4" /label=ARG4 /note="selectable marker ARG4 from C. albicans" promoter complement(3050..3068) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" rep_origin complement(3326..3914) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4088..4945) /label=AmpR /note="beta-lactamase" promoter complement(4946..5050) /label=AmpR promoter promoter 5396..5412 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.