Basic Vector Information
- Vector Name:
- pEZY45
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8718 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Guo F, Wang Y, Zhang YZ.
- Promoter:
- GAL1
pEZY45 vector Vector Map
pEZY45 vector Sequence
LOCUS 40924_19006 8718 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pEZY45, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8718) AUTHORS Guo F, Wang Y, Zhang YZ. TITLE Construction of two recombination yeast two-hybrid vectors by in vitro recombination JOURNAL Mol. Biotechnol. 36 (1), 38-43 (2007) PUBMED 17827536 REFERENCE 2 (bases 1 to 8718) AUTHORS Guo F, Wang Y, Zhang Y-Z. TITLE Direct Submission JOURNAL Submitted (28-SEP-2007) Biological, Chemical, and Physical Sciences, Illinois Institute of Technology, 3101 South Dearborn St., Chicago, IL 60616, USA REFERENCE 3 (bases 1 to 8718) TITLE Direct Submission REFERENCE 4 (bases 1 to 8718) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Mol. Biotechnol."; date: "2007"; volume: "36"; issue: "1"; pages: "38-43" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-SEP-2007) Biological, Chemical, and Physical Sciences, Illinois Institute of Technology, 3101 South Dearborn St., Chicago, IL 60616, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8718 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 81..522 /label=GAL1 promoter /note="inducible promoter, regulated by Gal4" CDS 546..566 /codon_start=1 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" /translation="PKKKRKV" CDS 573..809 /codon_start=1 /label=B42 transcriptional activator /note="yeast transcriptional activator cretaed from E. coli genomic DNA fragments (Ma and Ptashne, 1987)" /translation="INKDIEECNAIIEQFIDYLRTGQEMPMEMADQAINVVPGMTPKTI LHAGPPIQPDWLKSNGFHEIEADVNDTSLLLSGD" CDS 816..842 /codon_start=1 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" /translation="YPYDVPDYA" protein_bind 861..985 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" CDS complement(1417..1719) /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" CDS complement(2067..2723) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(2724..2826) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" protein_bind complement(3004..3128) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" terminator 3273..3460 /label=ADH1 terminator /note="transcription terminator for the S. cerevisiae alcohol dehydrogenase 1 (ADH1) gene" rep_origin 3982..5324 /label=2u ori /note="yeast 2u plasmid origin of replication" CDS complement(5688..6359) /codon_start=1 /label=TRP1 /note="phosphoribosylanthranilate isomerase, required for tryptophan biosynthesis" /translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA KK" promoter complement(6360..6461) /label=TRP1 promoter promoter 6564..6668 /label=AmpR promoter CDS 6669..7526 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 7700..8288 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 8576..8597 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 8612..8642 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 8650..8666 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 8674..8690 /label=M13 rev /note="common sequencing primer, one of multiple similar variants"
This page is informational only.