Basic Vector Information
- Vector Name:
- pEZ BAC
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 7260 bp
- Type:
- BAC cloning vector
- Replication origin:
- ori2
- Source/Author:
- Godiska R, Mead DA.
pEZ BAC vector Map
pEZ BAC vector Sequence
LOCUS 40924_18986 7260 bp DNA circular SYN 18-DEC-2018 DEFINITION BAC cloning vector pEZ BAC, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7260) AUTHORS Godiska R, Mead DA. TITLE CopyRight pEZ BAC vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 7260) AUTHORS Godiska R, Mead DA. TITLE Direct Submission JOURNAL Submitted (26-AUG-2008) Lucigen Corp., 2120 W. Greenview Dr. #9, Middleton, WI 53562, USA REFERENCE 3 (bases 1 to 7260) TITLE Direct Submission REFERENCE 4 (bases 1 to 7260) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-AUG-2008) Lucigen Corp., 2120 W. Greenview Dr. #9, Middleton, WI 53562, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7260 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(28..57) /label=T3Te terminator /note="phage T3 early transcription terminator" misc_recomb 79..112 /label=loxP site #1 /note="loxP site #1" protein_bind 79..112 /label=loxP /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." protein_bind 198..219 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 234..264 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 272..288 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 296..312 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 377..382 /label=HpaI blunt cloning site /note="HpaI blunt cloning site" promoter complement(411..429) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(436..452) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind complement(632..665) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." terminator complement(684..715) /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" misc_feature 764..1162 /label=cos /note="lambda cos site; allows packaging into phage lambda particles" promoter 1185..1287 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 1288..1944 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" misc_feature complement(2218..2691) /label=sopC /note="centromere-like partitioning region of the bacterial F plasmid" CDS complement(2767..3735) /codon_start=1 /label=sopB /note="partitioning protein for the bacterial F plasmid" /translation="MKRAPVIPKHTLNTQPVEDTSLSTPAAPMVDSLIARVGVMARGNA ITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQTP AFGRRVSGVIEIADGSRRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSAYER GQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGD ALQKAFTDKEELLKQQASNLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLSSRHQF APGATVLYKGDKMVLNLDRSRVPTECIEKIEAILKELEKPAP" CDS complement(3738..4910) /codon_start=1 /label=sopA /note="partitioning protein for the bacterial F plasmid" /translation="MFRMKLMETLNQCINAGHEMTKAIAIAQFNDDSPEARKITRRWRI GEAADLVGVSSQAIRDAEKAGRLPHPDMEIRGRVEQRVGYTIEQINHMRDVFGTRLRRA EDVFPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDL HIHAEDTLLPFYLGEKDDVTYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPTD PHLMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFF DMLRDLLKNVDLKGFEPDVRILLTKYSNSNGSQSPWMEEQIRDAWGSMVLKNVVRETDE VGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR" misc_feature complement(5236..5486) /label=incC /note="incompatibility region of the bacterial F plasmid" CDS complement(5492..6244) /codon_start=1 /label=repE /note="replication initiation protein for the bacterial F plasmid" /translation="MAETAVINHKKRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQ IRKSDGTLQEHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYRPEEDAG DEKGYESFPWFIKRAHSPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAM RLYESLCQYRKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPM RLSYIEKKKGRQTTHIVFSFRDITSMTTG" rep_origin complement(6335..6554) /direction=LEFT /label=ori2 /note="secondary origin of replication for the bacterial F plasmid; also known as oriS" rep_origin complement(6628..7257) /direction=LEFT /label=oriV /note="incP origin of replication"
This page is informational only.