pEXPR16 vector (V006423)

Basic Vector Information

Vector Name:
pEXPR16
Antibiotic Resistance:
Ampicillin
Length:
8052 bp
Type:
Mammalian expression vector
Replication origin:
ori
Source/Author:
Siciliano V.
Promoter:
EF-1α

pEXPR16 vector Map

pEXPR168052 bp400800120016002000240028003200360040004400480052005600600064006800720076008000oriAmpRAmpR promoterf1 oriM13 fwdT7 promoterHA-LSAattB4EF-1-alpha promoterattB1nNS3attB2beta-globin poly(A) signalM13 revlac operatorlac promoterCAP binding siteHA-RT3 promoterM13 revlac operatorlac promoterCAP binding site

pEXPR16 vector Sequence

LOCUS       40924_18851        8052 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Mammalian expression vector pEXPR16, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8052)
  AUTHORS   Siciliano V.
  TITLE     Engineering modular intracellular protein sensor-actuator devices
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 8052)
  AUTHORS   Siciliano V.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-MAR-2018) Biological Engineering, Massachusetts 
            Institute of Technology, 500 Tech Square, Cambridge, MA 02139, USA
REFERENCE   3  (bases 1 to 8052)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8052)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (22-MAR-2018) Biological Engineering, Massachusetts Institute of 
            Technology, 500 Tech Square, Cambridge, MA 02139, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8052
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(222..810)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(984..1841)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(1842..1946)
                     /label=AmpR promoter
     rep_origin      complement(1972..2427)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     2569..2585
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        2595..2613
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    2628..3431
                     /label=HA-L
                     /note="left homology arm from the adeno-associated virus 
                     integration site (AAVS1) within intron 1 of the human 
                     PPP1R12C gene"
     misc_feature    3510..3535
                     /label=SA
                     /note="splice acceptor site"
     protein_bind    4207..4227
                     /label=attB4
                     /note="core recombination site for the Gateway(R) BP
                     reaction"
     promoter        4252..5424
                     /label=EF-1-alpha promoter
                     /note="strong constitutive promoter for human elongation
                     factor EF-1-alpha"
     protein_bind    5446..5470
                     /label=attB1
                     /note="recombination site for the Gateway(R) BP reaction"
     regulatory      5473..5482
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     CDS             5479..6084
                     /codon_start=1
                     /product="nNS3"
                     /label=nNS3
                     /note="derived from HCV"
                     /protein_id="AVV68396.1"
                     /translation="MAPIGSVVIVGRIILSGRGGPITAYSQQTRGLLGCIITSLTGRDK
                     NQVEGEVQVVSTATQSFLATCVNGACWTVFHGAGSKTLAGPKGPITQMYTNVDQDLVGW
                     PAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDTRGSLLSPRPISYLKGSSGGPLL
                     CPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRGS"
     protein_bind    complement(6085..6109)
                     /label=attB2
                     /note="recombination site for the Gateway(R) BP reaction"
     polyA_signal    6264..6319
                     /label=beta-globin poly(A) signal
                     /note="rabbit beta-globin polyadenylation signal (Gil and 
                     Proudfoot, 1987)"
     primer_bind     complement(6680..6696)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    6704..6720
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(6728..6758)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    6773..6794
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     misc_feature    6967..7803
                     /label=HA-R
                     /note="right homology arm from the adeno-associated virus 
                     integration site (AAVS1) within intron 1 of the human 
                     PPP1R12C gene"
     promoter        complement(7833..7851)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(7872..7888)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(7896..7912)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(7920..7950)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(7965..7986)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."

This page is informational only.