Basic Vector Information
- Vector Name:
- pEXKm4
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6424 bp
- Type:
- Gene replacement vector
- Replication origin:
- ori
- Source/Author:
- Lopez CM, Rholl DA, Trunck LA, Schweizer HP.
- Promoter:
- Pc
pEXKm4 vector Map
pEXKm4 vector Sequence
LOCUS 40924_18821 6424 bp DNA circular SYN 18-DEC-2018 DEFINITION Gene replacement vector pEXKm4, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6424) AUTHORS Lopez CM, Rholl DA, Trunck LA, Schweizer HP. TITLE Versatile dual-technology system for markerless allele replacement in Burkholderia pseudomallei JOURNAL Appl. Environ. Microbiol. 75 (20), 6496-6503 (2009) PUBMED 19700544 REFERENCE 2 (bases 1 to 6424) AUTHORS Lopez CM, Schweizer HP. TITLE Direct Submission JOURNAL Submitted (02-MAR-2009) Microbiology, Immunology and Patholofy, Colorado State University, 3205 Rampart Rd., Fort Collins, CO 80523, USA REFERENCE 3 (bases 1 to 6424) TITLE Direct Submission REFERENCE 4 (bases 1 to 6424) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2009"; volume: "75"; issue: "20"; pages: "6496-6503" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-MAR-2009) Microbiology, Immunology and Patholofy, Colorado State University, 3205 Rampart Rd., Fort Collins, CO 80523, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6424 /mol_type="other DNA" /organism="synthetic DNA construct" oriT complement(427..536) /direction=LEFT /label=oriT /note="incP origin of transfer" terminator complement(961..988) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(1080..1166) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 1516..1532 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 1542..1559 /label=I-sceI site /note="I-sceI site" misc_feature 1560..1583 /label=multiple cloning site /note="multiple cloning site" misc_feature 1587..1604 /label=I-sceI site /note="I-sceI site" primer_bind complement(1623..1639) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1647..1663) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1671..1701) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1716..1737) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2025..2613) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 2759..2806 /note="FRT; Flp recombinase target site" protein_bind complement(2759..2806) /label=FRT /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." CDS 3192..3983 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" promoter 4046..4074 /label=Pc promoter /note="class 1 integron promoter" CDS 4400..6208 /codon_start=1 /gene="gusA" /product="GusA" /label=gusA /note="beta-D-glucuronidase" /protein_id="ACO48891.1" /translation="MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAI AVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEV MEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHD FFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQ VVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQF LINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDW ADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARD KNHPSVVMWSIANEPDTRPQVHGNISPLAEATRKLDPTRPITCVNVMFCDAHTDTISDL FDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYT DMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKP KSAAFLLQKRWTGMNFGEKPQQGGKQ" gene 4400..6208 /gene="gusA" /label=gusA protein_bind complement(6350..6397) /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)."
This page is informational only.