Basic Vector Information
- Vector Name:
- pEX302
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4188 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Zaltsman A, Krichevsky A, Loyter A, Citovsky V.
pEX302 vector Map
pEX302 vector Sequence
LOCUS 40924_18796 4188 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pEX302, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4188) AUTHORS Zaltsman A, Krichevsky A, Loyter A, Citovsky V. TITLE Agrobacterium induces expression of a host F-box protein required for tumorigenicity JOURNAL Cell Host Microbe 7 (3), 197-209 (2010) PUBMED 20227663 REFERENCE 2 (bases 1 to 4188) AUTHORS Zaltsman A, Krichevsky A, Citovsky V. TITLE Direct Submission JOURNAL Submitted (14-OCT-2008) Biochemistry and Cell Biology, SUNYSB, NY 11794, USA REFERENCE 3 (bases 1 to 4188) TITLE Direct Submission REFERENCE 4 (bases 1 to 4188) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell Host Microbe"; date: "2010"; volume: "7"; issue: "3"; pages: "197-209" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-OCT-2008) Biochemistry and Cell Biology, SUNYSB, NY 11794, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4188 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 71..87 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 94..112 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 249..265 /label=KS primer /note="common sequencing primer, one of multiple similar variants" primer_bind complement(299..315) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(889..907) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(928..944) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(952..968) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(976..1006) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1021..1042) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(1114..2259) /codon_start=1 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR" CDS complement(2561..3352) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHLERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" rep_origin complement(join(3561..4188,1..2)) /direction=LEFT /label=oriV /note="incP origin of replication"
This page is informational only.