Basic Vector Information
- Vector Name:
- pEUI(+)
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8166 bp
- Type:
- Inducible gene expression vector
- Replication origin:
- ori
- Source/Author:
- Lee S, Ro H.
- Promoter:
- SV40
pEUI(+) vector Map
pEUI(+) vector Sequence
LOCUS 40924_18651 8166 bp DNA circular SYN 18-DEC-2018 DEFINITION Inducible gene expression vector pEUI(+), complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8166) AUTHORS Lee S, Ro H. TITLE Transgene inducible vector, pEUI(+) JOURNAL Unpublished REFERENCE 2 (bases 1 to 8166) AUTHORS Lee S, Ro H. TITLE Direct Submission JOURNAL Submitted (10-NOV-2014) College of Bioscience and Biotechnology, Chungnam National University, Daekak-ro, Yuseong-gu, Daejeon, Chungcheongnam-do 305-764, Reublic of Korea REFERENCE 3 (bases 1 to 8166) TITLE Direct Submission REFERENCE 4 (bases 1 to 8166) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-NOV-2014) College of Bioscience and Biotechnology, Chungnam National University, Daekak-ro, Yuseong-gu, Daejeon, Chungcheongnam-do 305-764, Reublic of Korea" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8166 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 177..556 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 557..760 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" promoter 805..823 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 843..1280 /codon_start=1 /label=GAL4 DNA binding domain /note="DNA binding domain of the GAL4 transcriptional activator" /translation="MKLQSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTK RSPLTRAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQDNVNK DAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTV" promoter complement(2385..2403) /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" polyA_signal 2429..2653 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" rep_origin 2699..3127 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 3236..3565 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 3658..4254 /codon_start=1 /label=PuroR /note="puromycin N-acetyltransferase" /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS APRNLPFYERLGFTVTADVECPKDRATWCMTRKPGA" polyA_signal 4487..4621 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" protein_bind 5376..5396 /label=attB4 /note="core recombination site for the Gateway(R) BP reaction" promoter 5398..5416 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 5442..5458 /label=KS primer /note="common sequencing primer, one of multiple similar variants" promoter 5797..5815 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" promoter complement(5907..5924) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" polyA_signal complement(5929..6063) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" promoter complement(6176..6194) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" promoter 6332..6436 /label=AmpR promoter CDS 6437..7294 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 7468..8056 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.