Basic Vector Information
- Vector Name:
- pETBK
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3223 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Tanaka S, Onda M.
pETBK vector Map
pETBK vector Sequence
LOCUS 40924_18496 3223 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pETBK, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3223) AUTHORS Tanaka S, Onda M. TITLE Bacterial expression with pETBK JOURNAL Unpublished REFERENCE 2 (bases 1 to 3223) AUTHORS Tanaka S, Onda M. TITLE Direct Submission JOURNAL Submitted (29-JUL-2009) BioDynamics Laboratory Inc., 9-7 Hongo 2-Chome, Bunkyo-Ku, Tokyo 113-0033, Japan REFERENCE 3 (bases 1 to 3223) TITLE Direct Submission REFERENCE 4 (bases 1 to 3223) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-JUL-2009) BioDynamics Laboratory Inc., 9-7 Hongo 2-Chome, Bunkyo-Ku, Tokyo 113-0033, Japan" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3223 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 171..189 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" RBS 221..243 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 263..280 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 284..316 /codon_start=1 /label=T7 tag (gene 10 leader) /note="leader peptide from bacteriophage T7 gene 10" /translation="MASMTGGQQMG" CDS 320..334 /codon_start=1 /label=enterokinase site /note="enterokinase recognition and cleavage site" /translation="DDDDK" misc_feature 334..380 /label=multiple cloning site /note="multiple cloning site" terminator 456..503 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS 703..1515 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1676..2264 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2450..2592) /label=bom /note="basis of mobility region from pBR322" CDS complement(2697..2885) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL"
This page is informational only.