Basic Vector Information
- Vector Name:
- pET28-B18R(HisTag)
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6387 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Kim YG, Baltabekova AZ, Zhiyenbay EE, Aksambayeva AS, Shagyrova ZS, Khannanov R, Ramanculov EM, Shustov AV.
pET28-B18R(HisTag) vector Vector Map
pET28-B18R(HisTag) vector Sequence
LOCUS 40924_18386 6387 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pET28-B18R(HisTag), complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6387) AUTHORS Kim YG, Baltabekova AZ, Zhiyenbay EE, Aksambayeva AS, Shagyrova ZS, Khannanov R, Ramanculov EM, Shustov AV. TITLE Recombinant Vaccinia virus-coded interferon inhibitor B18R: Expression, refolding and a use in a mammalian expression system with a RNA-vector JOURNAL PLoS ONE 12 (12), e0189308 (2017) PUBMED 29216299 REFERENCE 2 (bases 1 to 6387) AUTHORS Shustov AV, Kim YG, Baltabekova AZ. TITLE Direct Submission JOURNAL Submitted (30-OCT-2017) National Center for Biotechnology, Kurgalzhinskoe ave. 13/5, Astana, Akmolinskaya obl. 010000, Kazakhstan REFERENCE 3 (bases 1 to 6387) TITLE Direct Submission REFERENCE 4 (bases 1 to 6387) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2017"; volume: "12"; issue: "12"; pages: "e0189308" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-OCT-2017) National Center for Biotechnology, Kurgalzhinskoe ave. 13/5, Astana, Akmolinskaya obl. 010000, Kazakhstan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: Vector NTI v. 11.5 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6387 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 2..20 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 21..45 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 60..82 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 102..119 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 123..155 /codon_start=1 /label=T7 tag (gene 10 leader) /note="leader peptide from bacteriophage T7 gene 10" /translation="MASMTGGQQMG" CDS 159..182 /codon_start=1 /label=Xpress(TM) tag /note="Xpress(TM) epitope tag, including an enterokinase recognition and cleavage site" /translation="DLYDDDDK" CDS 1249..1266 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 1333..1380 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" rep_origin 1417..1872 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(1968..2780) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2902..3490 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(3676..3818) /label=bom /note="basis of mobility region from pBR322" CDS complement(3923..4111) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" protein_bind complement(4886..4907) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(4923..6002) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(6003..6080) /label=lacI promoter
This page is informational only.