Basic Vector Information
- Vector Name:
- pET21b+PA
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7182 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Vahedi F, Sankian M, Mahmoudi M.
pET21b+PA vector Map
pET21b+PA vector Sequence
LOCUS 40924_18356 7182 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pET21b+PA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7182) AUTHORS Vahedi F, Sankian M, Mahmoudi M. TITLE Functional expression of Bacillus anthracis protective antigen in E. coli JOURNAL Appl. Biochem. Biotechnol. 157 (3), 554-561 (2009) PUBMED 18654743 REFERENCE 2 (bases 1 to 7182) AUTHORS Vahedi F, Mahmoudi M. TITLE Direct Submission JOURNAL Submitted (07-APR-2007) Immunology, Razi Vaccine and Serum Institute, Ahmad Abad, Mashhad 91735, Iran REFERENCE 3 (bases 1 to 7182) TITLE Direct Submission REFERENCE 4 (bases 1 to 7182) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Biochem. Biotechnol."; date: "2009"; volume: "157"; issue: "3"; pages: "554-561" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (07-APR-2007) Immunology, Razi Vaccine and Serum Institute, Ahmad Abad, Mashhad 91735, Iran" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7182 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(26..73) /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS complement(140..157) /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS complement(206..238) /codon_start=1 /label=T7 tag (gene 10 leader) /note="leader peptide from bacteriophage T7 gene 10" /translation="MASMTGGQQMG" RBS complement(246..268) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" protein_bind complement(283..307) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(308..326) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter 635..712 /label=lacI promoter CDS 713..1792 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 1808..1829 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS 2604..2792 /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" misc_feature 2897..3039 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(3225..3813) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3987..4844) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(4845..4949) /label=AmpR promoter rep_origin complement(4976..5431) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" gene 5462..7147 /gene="pa" /label=pa /note="protective antigen fragment; derived from Bacillus anthracis isolate 34F2 plasmid pXO1"
This page is informational only.