pET-RA vector (V006505)

Basic Vector Information

Vector Name:
pET-RA
Length:
6819 bp
Type:
Acinetobacter baumannii cloning vector
Replication origin:
ori
Source/Author:
Aranda J, Poza M, Gomez B, Rumbo S, Rumbo C, Parreira JR, Rodriguez P, Bou G.

pET-RA vector Map

pET-RA6819 bp3006009001200150018002100240027003000330036003900420045004800510054005700600063006600yeGFPrep_originrrnB T1 terminatorrrnB T2 terminatorAmpR promoterAmpR promoterarr-2oribomrop

pET-RA vector Sequence

LOCUS       40924_18226        6819 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Acinetobacter baumannii cloning vector pET-RA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6819)
  AUTHORS   Aranda J, Poza M, Gomez B, Rumbo S, Rumbo C, Parreira JR, Rodriguez 
            P, Bou G.
  TITLE     A rapid and simple method for constructing stable mutants of 
            Acinetobacter baumannii
  JOURNAL   BMC Microbiol. 10 (1), 279 (2010)
  PUBMED    21062436
REFERENCE   2  (bases 1 to 6819)
  AUTHORS   Poza M, Aranda J, Bou G.
  TITLE     pET-RA cloning vector for Acinetobacter baumannii
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 6819)
  AUTHORS   Poza M, Aranda J, Bou G.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-MAY-2010) Microbiology, University Hospital A Coruna, 
            Spain, As Xubias, A Coruna, A Coruna 15006, Spain
REFERENCE   4  (bases 1 to 6819)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 6819)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "BMC 
            Microbiol."; date: "2010"; volume: "10"; issue: "1"; pages: "279"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (11-MAY-2010) Microbiology, University Hospital A Coruna, Spain, As 
            Xubias, A Coruna, A Coruna 15006, Spain"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6819
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             52..765
                     /label=yeGFP
                     /note="yeast-enhanced green fluorescent protein"
     rep_origin      860..2197
     terminator      2406..2492
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      2584..2611
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        2630..2721
                     /label=AmpR promoter
     promoter        2732..2836
                     /label=AmpR promoter
     CDS             3137..3628
                     /codon_start=1
                     /gene="arr-2"
                     /product="rifampin ADP-ribosylating transferase ARR-2"
                     /label=arr-2
                     /note="confers rifampin resistance"
                     /protein_id="ADH43300.1"
                     /translation="MLCSQIPTIKGLKMVKDWIPISHDNYKQVQGPFYHGTKANLAIGD
                     LLTTGFISHFEDGRILKHIYFSALMEPAVWGAELAMSLSGLEGRGYIYIVEPTGPFEDD
                     PNLTNKKFPGNPTQSYRTCEPLRIVGVVEDWEGHPVELIRGMLDSLEDLKRRGLHVIED
                     "
     rep_origin      3847..4435
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(4621..4761)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     CDS             complement(4866..5054)
                     /label=rop
                     /note="Rop protein, which maintains plasmids at low copy
                     number"

This page is informational only.