Basic Vector Information
- Vector Name:
- pET-RA
- Length:
- 6819 bp
- Type:
- Acinetobacter baumannii cloning vector
- Replication origin:
- ori
- Source/Author:
- Aranda J, Poza M, Gomez B, Rumbo S, Rumbo C, Parreira JR, Rodriguez P, Bou G.
pET-RA vector Map
pET-RA vector Sequence
LOCUS 40924_18226 6819 bp DNA circular SYN 18-DEC-2018 DEFINITION Acinetobacter baumannii cloning vector pET-RA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6819) AUTHORS Aranda J, Poza M, Gomez B, Rumbo S, Rumbo C, Parreira JR, Rodriguez P, Bou G. TITLE A rapid and simple method for constructing stable mutants of Acinetobacter baumannii JOURNAL BMC Microbiol. 10 (1), 279 (2010) PUBMED 21062436 REFERENCE 2 (bases 1 to 6819) AUTHORS Poza M, Aranda J, Bou G. TITLE pET-RA cloning vector for Acinetobacter baumannii JOURNAL Unpublished REFERENCE 3 (bases 1 to 6819) AUTHORS Poza M, Aranda J, Bou G. TITLE Direct Submission JOURNAL Submitted (11-MAY-2010) Microbiology, University Hospital A Coruna, Spain, As Xubias, A Coruna, A Coruna 15006, Spain REFERENCE 4 (bases 1 to 6819) TITLE Direct Submission REFERENCE 5 (bases 1 to 6819) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "BMC Microbiol."; date: "2010"; volume: "10"; issue: "1"; pages: "279" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (11-MAY-2010) Microbiology, University Hospital A Coruna, Spain, As Xubias, A Coruna, A Coruna 15006, Spain" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..6819 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 52..765 /label=yeGFP /note="yeast-enhanced green fluorescent protein" rep_origin 860..2197 terminator 2406..2492 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2584..2611 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 2630..2721 /label=AmpR promoter promoter 2732..2836 /label=AmpR promoter CDS 3137..3628 /codon_start=1 /gene="arr-2" /product="rifampin ADP-ribosylating transferase ARR-2" /label=arr-2 /note="confers rifampin resistance" /protein_id="ADH43300.1" /translation="MLCSQIPTIKGLKMVKDWIPISHDNYKQVQGPFYHGTKANLAIGD LLTTGFISHFEDGRILKHIYFSALMEPAVWGAELAMSLSGLEGRGYIYIVEPTGPFEDD PNLTNKKFPGNPTQSYRTCEPLRIVGVVEDWEGHPVELIRGMLDSLEDLKRRGLHVIED " rep_origin 3847..4435 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(4621..4761) /label=bom /note="basis of mobility region from pBR322" CDS complement(4866..5054) /label=rop /note="Rop protein, which maintains plasmids at low copy number"
This page is informational only.