Basic Vector Information
- Vector Name:
- pES4
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5209 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Zhang X, Wang XY, Jia YL, Guo X, Wang YF, Wang TY.
- Promoter:
- CMV
pES4 vector Vector Map
pES4 vector Sequence
LOCUS 40924_17596 5209 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pES4, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5209) AUTHORS Zhang X, Wang XY, Jia YL, Guo X, Wang YF, Wang TY. TITLE A Vector Based on the Chicken Hypersensitive Site 4 Insulator Element Replicates Episomally in Mammalian Cell JOURNAL Curr Gene Ther (2017) In press PUBMED 28155604 REFERENCE 2 (bases 1 to 5209) AUTHORS Wang T. TITLE Direct Submission JOURNAL Submitted (22-JAN-2017) Department of Biochemistry and Molecular Biology, Xinxiang Medical University, Jinsui Road, Xinxiang, Henan 453000, Xinxiang REFERENCE 3 (bases 1 to 5209) TITLE Direct Submission REFERENCE 4 (bases 1 to 5209) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Curr Gene Ther (2017) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-JAN-2017) Department of Biochemistry and Molecular Biology, Xinxiang Medical University, Jinsui Road, Xinxiang, Henan 453000, Xinxiang" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5209 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 613..1329 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" misc_feature 1808..1873 /label=MCS /note="multiple cloning site" polyA_signal 1997..2118 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(2125..2580) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2607..2711 /label=AmpR promoter promoter 2713..3070 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 3105..3896 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 4131..4178 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4507..5095 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.