Basic Vector Information
- Vector Name:
- pERV3
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8363 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Vaillancourt P, Grafsky AJ.
- Promoter:
- CMV
pERV3 vector Map
pERV3 vector Sequence
LOCUS V006528 8363 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V006528 VERSION V006528 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8363) AUTHORS Vaillancourt P, Grafsky AJ. TITLE Direct Submission JOURNAL Submitted (13-OCT-1998) Technical Services, Stratagene, 11011 N. Torrey Pines Road, La Jolla, CA 92037, USA REFERENCE 2 (bases 1 to 8363) TITLE Direct Submission REFERENCE 3 (bases 1 to 8363) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (13-OCT-1998) Technical Services, Stratagene, 11011 N. Torrey Pines Road, La Jolla, CA 92037, USA" SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..8363 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 7..462 /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" polyA_signal complement(468..600) /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" intron complement(759..824) /label="small t intron" /note="SV40 (simian virus 40) small t antigen intron" CDS complement(912..2297) /gene="RXRA" /label="Retinoic acid receptor RXR-alpha" /note="Retinoic acid receptor RXR-alpha from Homo sapiens. Accession#: P19793" CDS complement(2295..2324) /codon_start=1 /product="Myc (human c-Myc proto-oncogene) epitope tag" /label="Myc" /translation="EQKLISEEDL" misc_feature complement(2324..2902) /label="IRES2" /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS complement(2910..4760) /codon_start=1 /product="ecdysone receptor VgEcR" /label="ecdysone receptor VgEcR" /protein_id="AAC95155.1" /translation="MLGERKDRASGYHYNALTCGSCKVFFRRSVTKSAVYCCKFGRACE MDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREKKAQKEKDKMTTSPSSQHGG NGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIY KLIWYQDGYEQPSEEDLRRIMSQPDENESQTDVSFRHITEITILTVQLIVEFAKGLPAF TKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIED LLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHC GDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDVHAIPPSVQS HLQITQEENERLERAERMRASVGGAITAGIDCDSASTSAAAAAAQHQPQPQPQPQPSSL TQNDSQHQTQPQLQPQLPPQLQGQLQPQLHPQLQTQLQPQIQPQPQLLPVSAPVPASVT APGSLSAVSTSSEYMGGSAAIGPITPATTSSITAAVTASSTTSAVPMGNGVGVGVGVGG NVSMYANAQTAMALMGVALHSHQEQLIGGVAVKSEHSTTA" CDS complement(4844..5077) /label="VP16 AD" /note="transcriptional activation domain of herpes simplex virus protein VP16 (Triezenberg et al., 1988; Cousens et al., 1989)" CDS complement(5078..5107) /label="Myc" /note="Myc (human c-Myc proto-oncogene) epitope tag" regulatory 5107..5116 /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" promoter complement(5153..5356) /label="CMV promoter" /note="human cytomegalovirus (CMV) immediate early promoter" enhancer complement(5357..5660) /label="CMV enhancer" /note="human cytomegalovirus immediate early enhancer" rep_origin complement(5855..6443) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" polyA_signal complement(6772..6819) /label="HSV TK poly(A) signal" /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" CDS complement(7054..7845) /label="NeoR/KanR" /note="aminoglycoside phosphotransferase" promoter complement(7880..8237) /label="SV40 promoter" /note="SV40 enhancer and early promoter" promoter complement(8239..8343) /label="AmpR promoter"
This page is informational only.