Basic Vector Information
- Vector Name:
- pERV3
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8363 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Vaillancourt P, Grafsky AJ.
- Promoter:
- CMV
pERV3 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pERV3 vector Sequence
LOCUS V006528 8363 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V006528 VERSION V006528 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8363) AUTHORS Vaillancourt P, Grafsky AJ. TITLE Direct Submission JOURNAL Submitted (13-OCT-1998) Technical Services, Stratagene, 11011 N. Torrey Pines Road, La Jolla, CA 92037, USA REFERENCE 2 (bases 1 to 8363) TITLE Direct Submission REFERENCE 3 (bases 1 to 8363) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (13-OCT-1998) Technical Services, Stratagene, 11011 N. Torrey Pines Road, La Jolla, CA 92037, USA" SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..8363 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 7..462 /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" polyA_signal complement(468..600) /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" intron complement(759..824) /label="small t intron" /note="SV40 (simian virus 40) small t antigen intron" CDS complement(912..2297) /gene="RXRA" /label="Retinoic acid receptor RXR-alpha" /note="Retinoic acid receptor RXR-alpha from Homo sapiens. Accession#: P19793" CDS complement(2295..2324) /codon_start=1 /product="Myc (human c-Myc proto-oncogene) epitope tag" /label="Myc" /translation="EQKLISEEDL" misc_feature complement(2324..2902) /label="IRES2" /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS complement(2910..4760) /codon_start=1 /product="ecdysone receptor VgEcR" /label="ecdysone receptor VgEcR" /protein_id="AAC95155.1" /translation="MLGERKDRASGYHYNALTCGSCKVFFRRSVTKSAVYCCKFGRACE MDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREKKAQKEKDKMTTSPSSQHGG NGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIY KLIWYQDGYEQPSEEDLRRIMSQPDENESQTDVSFRHITEITILTVQLIVEFAKGLPAF TKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIED LLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHC GDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDVHAIPPSVQS HLQITQEENERLERAERMRASVGGAITAGIDCDSASTSAAAAAAQHQPQPQPQPQPSSL TQNDSQHQTQPQLQPQLPPQLQGQLQPQLHPQLQTQLQPQIQPQPQLLPVSAPVPASVT APGSLSAVSTSSEYMGGSAAIGPITPATTSSITAAVTASSTTSAVPMGNGVGVGVGVGG NVSMYANAQTAMALMGVALHSHQEQLIGGVAVKSEHSTTA" CDS complement(4844..5077) /label="VP16 AD" /note="transcriptional activation domain of herpes simplex virus protein VP16 (Triezenberg et al., 1988; Cousens et al., 1989)" CDS complement(5078..5107) /label="Myc" /note="Myc (human c-Myc proto-oncogene) epitope tag" regulatory 5107..5116 /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" promoter complement(5153..5356) /label="CMV promoter" /note="human cytomegalovirus (CMV) immediate early promoter" enhancer complement(5357..5660) /label="CMV enhancer" /note="human cytomegalovirus immediate early enhancer" rep_origin complement(5855..6443) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" polyA_signal complement(6772..6819) /label="HSV TK poly(A) signal" /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" CDS complement(7054..7845) /label="NeoR/KanR" /note="aminoglycoside phosphotransferase" promoter complement(7880..8237) /label="SV40 promoter" /note="SV40 enhancer and early promoter" promoter complement(8239..8343) /label="AmpR promoter"
This page is informational only.