pENTRHBM-CBDBMP4-TVMV vector (V006533)

Download GeneBank File(.gb)

LOCUS       40924_17542        3423 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pENTRHBM-CBDBMP4-TVMV DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3423)
  AUTHORS   Imai S, Li Z, Miyagawa Y, Toyoda M, Umezawa A, Mon H, Kusakabe T, 
            Yoshimura K, Lee JM.
  TITLE     Biologically active human bone morphogenetic protein 4-fused to 
            collagen binding domain produced in silkworm-baculovirus expression 
            system
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3423)
  AUTHORS   Lee JM, Li Z, Kusakabe T.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-FEB-2013) Contact:Jae Man Lee Laboratory of Silkworm 
            Science, Kyushu University Graduate School of Bioresource and 
            Bioenvironmental Sciences; 6-10-1 Hakozaki, Higashi-ku, Fukuoka 
            812-8581, Japan E-mail :jaemanle@agr.kyushu-u.ac.jp Phone 
            :81-92-642-2842 Fax :81-92-642-2842
REFERENCE   3  (bases 1 to 3423)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3423)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (26-FEB-2013) Contact:Jae Man Lee Laboratory of Silkworm Science, 
            Kyushu University Graduate School of Bioresource and 
            Bioenvironmental Sciences"; volume: " 6-10-1 Hakozaki, Higashi-ku, 
            Fukuoka 812-8581, Japan E-mail :jaemanle@agr.kyushu-u.ac.jp Phone 
            :81-92-642-2842 Fax "; pages: "81-92-642-284"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3423
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     terminator      103..189
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      281..308
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     protein_bind    358..457
                     /label=attL1
                     /note="recombination site for the Gateway(R) LR reaction"
     sig_peptide     499..561
                     /label=melittin signal sequence
                     /note="signal sequence from honeybee melittin"
     CDS             1246..1260
                     /codon_start=1
                     /label=enterokinase site
                     /note="enterokinase recognition and cleavage site"
                     /translation="DDDDK"
     protein_bind    complement(1652..1751)
                     /label=attL2
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             1874..2680
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
                     DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
                     FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
                     FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
                     RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      2773..3361
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"