Basic Vector Information
- Vector Name:
- pENTRHBM-CBDBMP4-TVMV
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3423 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Imai S, Li Z, Miyagawa Y, Toyoda M, Umezawa A, Mon H, Kusakabe T, Yoshimura K, Lee JM.
pENTRHBM-CBDBMP4-TVMV vector Map
pENTRHBM-CBDBMP4-TVMV vector Sequence
LOCUS 40924_17542 3423 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pENTRHBM-CBDBMP4-TVMV DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3423) AUTHORS Imai S, Li Z, Miyagawa Y, Toyoda M, Umezawa A, Mon H, Kusakabe T, Yoshimura K, Lee JM. TITLE Biologically active human bone morphogenetic protein 4-fused to collagen binding domain produced in silkworm-baculovirus expression system JOURNAL Unpublished REFERENCE 2 (bases 1 to 3423) AUTHORS Lee JM, Li Z, Kusakabe T. TITLE Direct Submission JOURNAL Submitted (26-FEB-2013) Contact:Jae Man Lee Laboratory of Silkworm Science, Kyushu University Graduate School of Bioresource and Bioenvironmental Sciences; 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581, Japan E-mail :jaemanle@agr.kyushu-u.ac.jp Phone :81-92-642-2842 Fax :81-92-642-2842 REFERENCE 3 (bases 1 to 3423) TITLE Direct Submission REFERENCE 4 (bases 1 to 3423) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-FEB-2013) Contact:Jae Man Lee Laboratory of Silkworm Science, Kyushu University Graduate School of Bioresource and Bioenvironmental Sciences"; volume: " 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581, Japan E-mail :jaemanle@agr.kyushu-u.ac.jp Phone :81-92-642-2842 Fax "; pages: "81-92-642-284" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3423 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 103..189 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 281..308 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" protein_bind 358..457 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" sig_peptide 499..561 /label=melittin signal sequence /note="signal sequence from honeybee melittin" CDS 1246..1260 /codon_start=1 /label=enterokinase site /note="enterokinase recognition and cleavage site" /translation="DDDDK" protein_bind complement(1652..1751) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" CDS 1874..2680 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2773..3361 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.