Basic Vector Information
- Vector Name:
- pENTRHBM-CBDBMP4-TVMV
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3423 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Imai S, Li Z, Miyagawa Y, Toyoda M, Umezawa A, Mon H, Kusakabe T, Yoshimura K, Lee JM.
pENTRHBM-CBDBMP4-TVMV vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pENTRHBM-CBDBMP4-TVMV vector Sequence
LOCUS 40924_17542 3423 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pENTRHBM-CBDBMP4-TVMV DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3423)
AUTHORS Imai S, Li Z, Miyagawa Y, Toyoda M, Umezawa A, Mon H, Kusakabe T,
Yoshimura K, Lee JM.
TITLE Biologically active human bone morphogenetic protein 4-fused to
collagen binding domain produced in silkworm-baculovirus expression
system
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 3423)
AUTHORS Lee JM, Li Z, Kusakabe T.
TITLE Direct Submission
JOURNAL Submitted (26-FEB-2013) Contact:Jae Man Lee Laboratory of Silkworm
Science, Kyushu University Graduate School of Bioresource and
Bioenvironmental Sciences; 6-10-1 Hakozaki, Higashi-ku, Fukuoka
812-8581, Japan E-mail :jaemanle@agr.kyushu-u.ac.jp Phone
:81-92-642-2842 Fax :81-92-642-2842
REFERENCE 3 (bases 1 to 3423)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3423)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(26-FEB-2013) Contact:Jae Man Lee Laboratory of Silkworm Science,
Kyushu University Graduate School of Bioresource and
Bioenvironmental Sciences"; volume: " 6-10-1 Hakozaki, Higashi-ku,
Fukuoka 812-8581, Japan E-mail :jaemanle@agr.kyushu-u.ac.jp Phone
:81-92-642-2842 Fax "; pages: "81-92-642-284"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3423
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator 103..189
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 281..308
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
protein_bind 358..457
/label=attL1
/note="recombination site for the Gateway(R) LR reaction"
sig_peptide 499..561
/label=melittin signal sequence
/note="signal sequence from honeybee melittin"
CDS 1246..1260
/codon_start=1
/label=enterokinase site
/note="enterokinase recognition and cleavage site"
/translation="DDDDK"
protein_bind complement(1652..1751)
/label=attL2
/note="recombination site for the Gateway(R) LR reaction"
CDS 1874..2680
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
rep_origin 2773..3361
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.