pENTR223-ICK vector (V006539)

Basic Vector Information

Vector Name:
pENTR223-ICK
Antibiotic Resistance:
Streptomycin
Length:
3666 bp
Type:
Human ORFeome Gateway entry vector
Replication origin:
ori
Source/Author:
Rual JF, Hirozane-Kishikawa T, Hao T, Bertin N, Li S, Dricot A, Li N, Rosenberg J, Lamesch P, Vidalain PO, Clingingsmith TR, Hartley JL, Esposito D, Cheo D, Moore T, Simmons B, Sequerra R, Bosak S, Do

pENTR223-ICK vector Vector Map

pENTR223-ICK3666 bp60012001800240030003600rrnB T2 terminatorrrnB T1 terminatorM13 fwdattL2unnamed protein product; hICK; incomplete termination codon for C-terminal fusionattL2T7 promoterM13 revSmRori

pENTR223-ICK vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_17503        3666 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Human ORFeome Gateway entry vector pENTR223-ICK, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3666)
  AUTHORS   Rual JF, Hirozane-Kishikawa T, Hao T, Bertin N, Li S, Dricot A, Li 
            N, Rosenberg J, Lamesch P, Vidalain PO, Clingingsmith TR, Hartley 
            JL, Esposito D, Cheo D, Moore T, Simmons B, Sequerra R, Bosak S, 
            Doucette-Stamm L, Le Peuch C, Vandenhaute J, Cusick ME, Albala JS, 
            Hill DE, Vidal M.
  TITLE     Human ORFeome version 1.1: a platform for reverse proteomics
  JOURNAL   Genome Res. 14 (10B), 2128-2135 (2004)
  PUBMED    15489335
REFERENCE   2  (bases 1 to 3666)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 3666)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   4  (bases 1 to 3666)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 3666)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Genome Res.
            14 (10B), 2128-2135 (2004)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (06-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 
            9052, BELGIUM"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3666
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     terminator      complement(88..115)
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      complement(207..293)
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     primer_bind     357..373
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    389..486
                     /label=attL2
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             488..1365
                     /codon_start=1
                     /note="unnamed protein product; hICK; incomplete
                     termination codon for C-terminal fusion"
                     /protein_id="SJX33038.1"
                     /translation="MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEEC
                     MNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRN
                     IMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTR
                     WYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKT
                     DWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQVFFH
                     FLVITFISNSE"
     protein_bind    complement(1365..1464)
                     /label=attL2
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        complement(1482..1500)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(1505..1521)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             1952..2740
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     rep_origin      2836..3424
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.