Basic Vector Information
- Vector Name:
- pENTR223-ICK
- Antibiotic Resistance:
- Streptomycin
- Length:
- 3666 bp
- Type:
- Human ORFeome Gateway entry vector
- Replication origin:
- ori
- Source/Author:
- Rual JF, Hirozane-Kishikawa T, Hao T, Bertin N, Li S, Dricot A, Li N, Rosenberg J, Lamesch P, Vidalain PO, Clingingsmith TR, Hartley JL, Esposito D, Cheo D, Moore T, Simmons B, Sequerra R, Bosak S, Do
pENTR223-ICK vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pENTR223-ICK vector Sequence
LOCUS 40924_17503 3666 bp DNA circular SYN 18-DEC-2018
DEFINITION Human ORFeome Gateway entry vector pENTR223-ICK, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3666)
AUTHORS Rual JF, Hirozane-Kishikawa T, Hao T, Bertin N, Li S, Dricot A, Li
N, Rosenberg J, Lamesch P, Vidalain PO, Clingingsmith TR, Hartley
JL, Esposito D, Cheo D, Moore T, Simmons B, Sequerra R, Bosak S,
Doucette-Stamm L, Le Peuch C, Vandenhaute J, Cusick ME, Albala JS,
Hill DE, Vidal M.
TITLE Human ORFeome version 1.1: a platform for reverse proteomics
JOURNAL Genome Res. 14 (10B), 2128-2135 (2004)
PUBMED 15489335
REFERENCE 2 (bases 1 to 3666)
AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
Fonseca M, Vanhoucke M, Beyaert R.
TITLE BCCM/LMBP Plasmid collection
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 3666)
AUTHORS De Schamphelaire W.
TITLE Direct Submission
JOURNAL Submitted (06-FEB-2017) BCCM/LMBP, Universiteit Gent,
Technologiepark 927, 9052, BELGIUM
REFERENCE 4 (bases 1 to 3666)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 3666)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Genome Res.
14 (10B), 2128-2135 (2004)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(06-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
9052, BELGIUM"
COMMENT SGRef: number: 4; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3666
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator complement(88..115)
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator complement(207..293)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind 357..373
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 389..486
/label=attL2
/note="recombination site for the Gateway(R) LR reaction"
CDS 488..1365
/codon_start=1
/note="unnamed protein product; hICK; incomplete
termination codon for C-terminal fusion"
/protein_id="SJX33038.1"
/translation="MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEEC
MNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRN
IMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTR
WYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKT
DWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQVFFH
FLVITFISNSE"
protein_bind complement(1365..1464)
/label=attL2
/note="recombination site for the Gateway(R) LR reaction"
promoter complement(1482..1500)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(1505..1521)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
CDS 1952..2740
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
rep_origin 2836..3424
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.