Basic Vector Information
- Vector Name:
- pENTR223-F12
- Antibiotic Resistance:
- Streptomycin
- Length:
- 3690 bp
- Type:
- Human ORFeome Gateway entry vector
- Replication origin:
- ori
- Source/Author:
- Rual JF, Hirozane-Kishikawa T, Hao T, Bertin N, Li S, Dricot A, Li N, Rosenberg J, Lamesch P, Vidalain PO, Clingingsmith TR, Hartley JL, Esposito D, Cheo D, Moore T, Simmons B, Sequerra R, Bosak S, Do
pENTR223-F12 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pENTR223-F12 vector Sequence
LOCUS 40924_17493 3690 bp DNA circular SYN 18-DEC-2018 DEFINITION Human ORFeome Gateway entry vector pENTR223-F12, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3690) AUTHORS Rual JF, Hirozane-Kishikawa T, Hao T, Bertin N, Li S, Dricot A, Li N, Rosenberg J, Lamesch P, Vidalain PO, Clingingsmith TR, Hartley JL, Esposito D, Cheo D, Moore T, Simmons B, Sequerra R, Bosak S, Doucette-Stamm L, Le Peuch C, Vandenhaute J, Cusick ME, Albala JS, Hill DE, Vidal M. TITLE Human ORFeome version 1.1: a platform for reverse proteomics JOURNAL Genome Res. 14 (10B), 2128-2135 (2004) PUBMED 15489335 REFERENCE 2 (bases 1 to 3690) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 3 (bases 1 to 3690) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (06-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 4 (bases 1 to 3690) TITLE Direct Submission REFERENCE 5 (bases 1 to 3690) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Genome Res. 14 (10B), 2128-2135 (2004)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (06-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..3690 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(88..115) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(207..293) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 357..373 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 389..486 /label=attL2 /note="recombination site for the Gateway(R) LR reaction" CDS 488..1389 /codon_start=1 /note="unnamed protein product; hF12; incomplete termination codon for C-terminal fusion" /protein_id="SJX33376.1" /translation="MPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCG QRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPA PEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALL SPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDV HGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKP GVYTDVAYYLAWIREHTVS" protein_bind complement(1390..1488) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter complement(1506..1524) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(1529..1545) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 1976..2764 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" rep_origin 2860..3448 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.