Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V006558 | SaBE4-Gam | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- SaBE4-Gam
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8601 bp
- Type:
- Mammalian Expression
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- CMV
- Cloning Method:
- Gibson Cloning
- 5' Primer:
- T7
- 3' Primer:
- M13R
SaBE4-Gam vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
SaBE4-Gam vector Sequence
LOCUS V006558 8601 bp DNA circular SYN 13-MAY-2021 DEFINITION Exported. ACCESSION V006558 VERSION V006558 KEYWORDS SaBE4-Gam SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8601) AUTHORS Komor AC, Zhao KT, Packer MS, Gaudelli NM, Waterbury AL, Koblan LW, Kim YB, Badran AH, Liu DR TITLE Improved base excision repair inhibition and bacteriophage Mu Gam protein yields C:G-to-T:A base editors with higher efficiency and product purity. JOURNAL Sci Adv. 2017 Aug 30;3(8):eaao4774. doi: 10.1126/sciadv.aao4774. eCollection 2017 Aug. PUBMED 28875174 REFERENCE 2 (bases 1 to 8601) TITLE Direct Submission REFERENCE 3 (bases 1 to 8601) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Sci Adv."; date: "2017-08-30"; pages: " 10.1126/sciadv.aao4774. eCollection 2017 Aug" SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..8601 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 132..335 /label="CMV promoter" /note="human cytomegalovirus (CMV) immediate early promoter" promoter 377..395 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" CDS 409..930 /gene="gam" /label="Putative DNA ends protecting protein gam" /note="Putative DNA ends protecting protein gam from Escherichia phage Mu. Accession#: P06023" CDS 979..1662 /label="APOBEC-1" /note="cytidine deaminase (C to U editing enzyme) from rat" CDS 1762..4917 /label="SaCas9" /note="Cas9 endonuclease from the Staphylococcus aureus Type II CRISPR/Cas system" CDS 4924..4944 /codon_start=1 /product="nuclear localization signal of SV40 (simian virus 40) large T antigen" /label="SV40 NLS" /translation="PKKKRKV" CDS 4951..5016 /label="3xFLAG" /note="three tandem FLAG(R) epitope tags, followed by an enterokinase cleavage site" CDS 5047..5295 /label="UGI" /note="uracil-DNA glycosylase inhibitor from a Bacillus subtilis bacteriophage (Mol et al., 1995)" CDS 5326..5574 /codon_start=1 /product="uracil-DNA glycosylase inhibitor from a Bacillus subtilis bacteriophage (Mol et al., 1995)" /label="UGI" /translation="TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTA YDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML" CDS 5587..5607 /label="SV40 NLS" /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" CDS 5616..5633 /label="6xHis" /note="6xHis affinity tag" polyA_signal 5662..5886 /label="bGH poly(A) signal" /note="bovine growth hormone polyadenylation signal" primer_bind complement(5957..5973) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(5981..5997) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(6005..6035) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(6050..6071) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." primer_bind complement(6188..6205) /label="L4440" /note="L4440 vector, forward primer" rep_origin complement(6359..6947) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7121..7978) /label="AmpR" /note="beta-lactamase" promoter complement(7979..8083) /label="AmpR promoter" primer_bind complement(8162..8181) /label="pRS-marker" /note="pRS vectors, use to sequence yeast selectable marker" enhancer 8353..8601 /label="CMV enhancer" /note="human cytomegalovirus immediate early enhancer"