Basic Vector Information
- Vector Name:
- pHC82
- Antibiotic Resistance:
- Ampicillin
- Length:
- 11365 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Chou H-H., Berthet J, Marx CJ.
- Promoter:
- tet
pHC82 vector Map
pHC82 vector Sequence
LOCUS 40924_24278 11365 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pHC82, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11365) AUTHORS Chou H-H., Berthet J, Marx CJ. TITLE Growth rate modulates the selective advantage of recurrent transposition mutations arising from experimental populations grown in a metal-limited environment JOURNAL Unpublished REFERENCE 2 (bases 1 to 11365) AUTHORS Chou H-H. TITLE Direct Submission JOURNAL Submitted (15-OCT-2008) Organismic and Evolutionary Biology, Harvard University, 16 Divinity Avenue, Biolab 3079, Cambridge, MA 02138, USA REFERENCE 3 (bases 1 to 11365) TITLE Direct Submission REFERENCE 4 (bases 1 to 11365) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-OCT-2008) Organismic and Evolutionary Biology, Harvard University, 16 Divinity Avenue, Biolab 3079, Cambridge, MA 02138, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..11365 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(4..861) /label=AmpR /note="beta-lactamase" promoter complement(862..966) /label=AmpR promoter misc_feature 1053..4376 /note="icuAB.CM1059 allele of Methylobacterium extorquens AM1" CDS 2053..3267 /codon_start=1 /product="transposase" /label=transposase /note="transposase of ISMex4" /protein_id="ACR45013.1" /translation="MQIGEKLAAVIPDRRDPSRIVHPLPEILLARILAIACGYEDADDL DHLRVDPAFKLACGRLPDSGRDLMSQPTVSRLENTPGLRDLIRLGRVLVDLYCASYAAP PAAVTLDIDDTCDVVHGQQQLSLFNAHHDERCFLPIHVYDTATSRPVAMILRPGKTPSG REVRGHLRRLVRAIRRHWPTTAITIRGDGHYGRPEAMDWCEDNDVAYVFGLTGTKSLTA KVEPTADHIRVERALSNTDAVRGFAETTHAAKSWRQHRRVAARIEATRLGLDIRYVVTN IATGTPEWLYAELYCARGQAENLIKLHKGQLASDRTSCRHPAANQMRLVLHTAAYWLML TVRDAIPAPHRLAKAEFATIRLRLLKLGARIHETTARVRLAFAAACPEADLLRHIAGAL APAPA" CDS complement(4980..5348) /label=traJ /note="oriT-recognizing protein" oriT complement(5381..5490) /direction=LEFT /label=oriT /note="incP origin of transfer" promoter 6127..6155 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS 6203..7390 /label=TcR /note="tetracycline efflux protein" CDS complement(7574..8230) /label=CmR /note="chloramphenicol acetyltransferase" CDS complement(8331..9749) /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" promoter complement(9750..10195) /label=sacB promoter /note="sacB promoter and control region" rep_origin complement(10607..11195) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.