pHC42 vector (V005598)

LOCUS       40924_24208        8855 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Promoter-probe vector pHC42, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8855)
  AUTHORS   Chou H-H., Berthet J, Marx CJ.
  TITLE     Parallel transpositions of an insertion sequence drove adaptation of
            Methylobacterium in a metal-limited environment
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 8855)
  AUTHORS   Chou H-H.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-APR-2008) Organismic and Evolutionary Biology, Harvard
            University, 16 Divinity Avenue, Biolab 3079, Cambridge, MA 02138, 
            USA
REFERENCE   3  (bases 1 to 8855)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8855)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (27-APR-2008) Organismic and Evolutionary Biology, Harvard 
            University, 16 Divinity Avenue, Biolab 3079, Cambridge, MA 02138, 
            USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8855
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      3..712
                     /label=oriV
                     /note="incP origin of replication"
     rep_origin      1105..1693
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    1981..2002
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        2017..2047
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    2055..2071
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     2079..2095
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(2123..2836)
                     /label=GFPuv
                     /note="GFP variant optimized for excitation by UV light"
     regulatory      complement(2837..2851)
                     /note="derived from Methylobacterium extorquens AM1 fae
                     gene"
                     /regulatory_class="ribosome_binding_site"
     terminator      complement(3026..3053)
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      complement(3145..3231)
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     primer_bind     complement(3413..3429)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(3874..4515)
                     /label=TetR
                     /note="tetracycline resistance regulatory protein"
     CDS             complement(5296..6108)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     CDS             complement(6783..7928)
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"
     CDS             complement(8200..8571)
                     /codon_start=1
                     /gene="traJ"
                     /product="oriT-recognizing protein"
                     /label=traJ
                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSL*AYLLAV
                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE
                     KQDELGKVMMGVVRPRAEP"
     oriT            complement(8604..8713)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"