pHBurk5 vector (V005610)

Basic Vector Information

Vector Name:
pHBurk5
Antibiotic Resistance:
Kanamycin
Length:
7244 bp
Type:
Himar1-delivery and mutagenesis vector
Replication origin:
R6K γ ori
Source/Author:
Rholl DA, Trunck LA, Schweizer HP.

pHBurk5 vector Vector Map

pHBurk57244 bp300600900120015001800210024002700300033003600390042004500480051005400570060006300660069007200tnplac promoterFRTNeoR/KanRFRTKS primerR6K gamma orioriCAP binding sitelac promoterlac operatorM13 revpRO1600 ReppRO1600 oriVoriT

pHBurk5 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_24148        7244 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Himar1-delivery and mutagenesis vector pHBurk5, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7244)
  AUTHORS   Rholl DA, Trunck LA, Schweizer HP.
  TITLE     In vivo Himar1 transposon mutagenesis of Burkholderia pseudomallei
  JOURNAL   Appl. Environ. Microbiol. 74 (24), 7529-7535 (2008)
  PUBMED    18952878
REFERENCE   2  (bases 1 to 7244)
  AUTHORS   Rholl DA, Trunck LA, Schweizer HP.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUL-2008) Microbiology, Immunology and Pathology, 
            Colorado State University, 1692 Campus Delivery, Fort Collins, CO 
            80523, USA
REFERENCE   3  (bases 1 to 7244)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7244)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Environ. Microbiol."; date: "2008"; volume: "74"; issue: "24"; 
            pages: "7529-7535"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (23-JUL-2008) Microbiology, Immunology and Pathology, Colorado State
            University, 1692 Campus Delivery, Fort Collins, CO 80523, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7244
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(104..1150)
                     /codon_start=1
                     /gene="tnp"
                     /product="transposase"
                     /label=tnp
                     /note="Tnp"
                     /protein_id="ACK37849.1"
                     /translation="MEKKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWY
                     AKFKRGEMSTEDGERSGRPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGH
                     IIHQYLDMRKLCAKWVPRELTFDQKQQRVDDSERCLQLLTRNTPEFFRRYVTMDETWLH
                     HYTPESNRQSAEWTATGEPSPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSD
                     YYMALLERLKVEIAAKRPHMKKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSP
                     DLAPSDFFLFSDLKRMLAGKKFGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCI
                     ALEGNYVE"
     gene            complement(104..1150)
                     /gene="tnp"
                     /label=tnp
     repeat_region   1537..1565
     promoter        complement(1669..1699)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    1717..1764
                     /label=FRT
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     CDS             complement(1875..2666)
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     protein_bind    3052..3099
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     primer_bind     3159..3175
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      complement(3312..3700)
                     /direction=LEFT
                     /label=R6K gamma ori
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     repeat_region   3987..4015
     rep_origin      4589..5177
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    5465..5486
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        5501..5531
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    5539..5555
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     5563..5579
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(5660..6490)
                     /label=pRO1600 Rep
                     /note="replication protein for the broad-host-range plasmid
                     pRO1600 from Pseudomonas aeruginosa"
     rep_origin      6504..6855
                     /label=pRO1600 oriV
                     /note="broad-host-range origin of replication from
                     Pseudomonas aeruginosa plasmid pRO1600; requires the 
                     pRO1600 Rep protein for replication (West et al., 1994)"
     oriT            7072..7180
                     /label=oriT
                     /note="incP origin of transfer"

This page is informational only.