Basic Vector Information
- Vector Name:
- pHB576
- Antibiotic Resistance:
- Streptomycin
- Length:
- 3843 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Gao H, Xu X.
pHB576 vector Map
pHB576 vector Sequence
LOCUS 40924_24134 3843 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pHB576, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3843) AUTHORS Gao H, Xu X. TITLE Direct Submission JOURNAL Submitted (20-JUN-2007) Institute of Hydrobiology, Chinese Academy of Science, #7 Donghu South Rd, Wuchang, Wuhan, Hubei 430072, China REFERENCE 2 (bases 1 to 3843) TITLE Direct Submission REFERENCE 3 (bases 1 to 3843) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (20-JUN-2007) Institute of Hydrobiology, Chinese Academy of Science, #7 Donghu South Rd, Wuchang, Wuhan, Hubei 430072, China" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..3843 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 106..127 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 142..172 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 180..196 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 204..220 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 375..477 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 478..1134 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" primer_bind complement(1259..1275) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 1897..2685 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 3073..3661 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.