Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V005615 | pHapII | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
The HpaII promoter was a strong promoter and promoted the high expression of laz in Gram-negative bacteria and the cat in B. subtilis.
- Vector Name:
- pHapII
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6841 bp
- Type:
- GFP expression vector
- Replication origin:
- ori
- Source/Author:
- Zhang N, Wu K, He X, Li S-Q., Zhang Z-H., Shen B, Yang Y-M., Zhang R-F., Huang Q-W., Shen Q-R.
- Growth Strain(s):
- Top10
- Growth Temperature:
- 37℃
pHapII vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Zyprian E, Matzura H. Characterization of signals promoting gene expression on the Staphylococcus aureus plasmid pUB110 and development of a gram-positive expression vector system. DNA. 1986 Jun;5(3):219-25. doi: 10.1089/dna.1986.5.219. PMID: 3013549.
pHapII vector Sequence
LOCUS Exported 6841 bp DNA circular SYN 28-OCT-2024 DEFINITION Shuttle expression-secretion vector pP43NMK, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6841) AUTHORS Zhang XZ, Cui ZL, Hong Q, Li SP. TITLE High-level expression and secretion of methyl parathion hydrolase in Bacillus subtilis WB800 JOURNAL Appl. Environ. Microbiol. 71 (7), 4101-4103 (2005) PUBMED 16000826 REFERENCE 2 (bases 1 to 6841) AUTHORS Zhang X-Z., Cui Z-L., Li S-P. TITLE Direct Submission JOURNAL Submitted (25-OCT-2005) Department of Microbiology, College of Life Sciences, Nanjing Agricultural University, MOA Key Lab of Microbiological Engineering of Agricultural Environment, #6 Tongwei Road, Weigang, Nanjing, Jiangsu 210095, P. R. China REFERENCE 3 (bases 1 to 6841) TITLE Direct Submission REFERENCE 4 (bases 1 to 6841) TITLE Direct Submission REFERENCE 5 (bases 1 to 6841) TITLE Direct Submission REFERENCE 6 (bases 1 to 6841) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2005"; volume: "71"; issue: "7"; pages: "4101-4103" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-OCT-2005) Department of Microbiology, College of Life Sciences, Nanjing Agricultural University, MOA Key Lab of Microbiological Engineering of Agricultural Environment, #6 Tongwei Road, Weigang, Nanjing, Jiangsu 210095, P. R. China" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT SGRef: number: 4; type: "Journal Article" COMMENT SGRef: number: 5; type: "Journal Article" FEATURES Location/Qualifiers source 1..6841 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 814..1815 /label=repB /note="RepB replication protein" CDS 1987..2748 /codon_start=1 /gene="km" /product="Km" /label=km /protein_id="ABD24446.1" /translation="MNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTD GPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHGQFF SILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTTFLP SLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSDSEK LLESLENFWNGIQEWTERHGYIVDVSKRIPF" gene 1987..2748 /gene="km" /label=km CDS 2965..3369 /codon_start=1 /gene="ble" /product="Ble" /label=ble /protein_id="ABD24447.1" /translation="MRMLQSIPALPVGDIKKSIGFYCDKLGFTLVHHEDGFAVLMCNEV RIHLWEASDEGWRSRSNDSPVCTGAESFIAGTASCRIEVEGIDELYQHIKPLGILHPNT SLKDQWWDERDFAVIDPDNNLISFFQQIKS" gene 2965..3217 /gene="ble" /label=ble promoter 3589..3808 /label=Hpa II promoter RBS 3859..3867 CDS 3876..4589 /codon_start=1 /product="S65T variant of Aequorea victoria green fluorescent protein (Heim et al., 1995)" /label=GFP (S65T) /note="excitable with blue light" /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAAGITHGMDELYK" primer_bind complement(4620..4636) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4644..4660) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4668..4698) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4713..4734) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(5022..5610) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5784..6641) /label=AmpR /note="beta-lactamase" promoter complement(6642..6746) /label=AmpR promoter