pGWnV4 vector (V005629)

Download GeneBank File(.gb)

LOCUS       40924_23974        6640 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Gateway vector pGWnV4 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6640)
  AUTHORS   Nishimura K, Matsunami E, Yoshida S, Kohata S, Yamauchi J, Jisaka M,
            Nagaya T, Yokota K, Nakagawa T.
  TITLE     The tyrosine-sorting motif of the vacuolar sorting receptor VSR4 
            from Arabidopsis thaliana, which is involved in the interaction 
            between VSR4 and AP1M2, mu1-adaptin type 2 of clathrin adaptor 
            complex 1 subunits, participates in the post-Golgi sorting of VSR4
  JOURNAL   Biosci. Biotechnol. Biochem. 80 (4), 694-705 (2016)
  PUBMED    26745465
REFERENCE   2  (bases 1 to 6640)
  AUTHORS   Nishimura K, Matsunami E.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-FEB-2015) Contact:Kohji Nishimura Shimane University, 
            Organization of Research; 1060 Nishikawatsu, Matsue, Shimane 
            690-8504, Japan
REFERENCE   3  (bases 1 to 6640)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6640)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Biosci. 
            Biotechnol. Biochem."; date: "2016"; volume: "80"; issue: "4"; 
            pages: "694-705"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (24-FEB-2015) Contact:Kohji Nishimura Shimane University, 
            Organization of Research; 1060 Nishikawatsu, Matsue, Shimane 
            690-8504, Japan"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     constructed using pUC119.
FEATURES             Location/Qualifiers
     source          1..6640
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    107..128
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        143..173
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    181..197
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     205..221
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        763..1108
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     protein_bind    1130..1254
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        1291..1321
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     CDS             1375..2031
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     CDS             2376..2678
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     protein_bind    complement(2722..2846)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_feature    2857..3486
                     /note="n-terminal fragment of yellow fluorescent protein 
                     (replacement of gcc with aag at 3475-3477)"
     CDS             2857..3375
                     /codon_start=1
                     /product="N-terminal fragment of mVenus for use in
                     bimolecular fluorescence complementation (BiFC) (Kodama and
                     Hu, 2010)"
                     /label=VN173
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK
                     ANFKIRHNIE"
     terminator      3508..3760
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     primer_bind     complement(3769..3785)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      3998..4453
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        4735..4839
                     /label=AmpR promoter
     CDS             4840..5697
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      5871..6459
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"