Basic Vector Information
- Vector Name:
- pGWB726
- Antibiotic Resistance:
- Streptomycin
- Length:
- 12196 bp
- Type:
- Gateway binary vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Tanaka Y, Nakamura S, Kawamukai M, Koizumi N, Nakagawa T.
- Promoter:
- CaMV35S(long)
pGWB726 vector Map
pGWB726 vector Sequence
LOCUS 40924_23779 12196 bp DNA circular SYN 18-DEC-2018 DEFINITION Gateway binary vector pGWB726 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12196) AUTHORS Tanaka Y, Nakamura S, Kawamukai M, Koizumi N, Nakagawa T. TITLE Development of a series of gateway binary vectors possessing a tunicamycin resistance gene as a marker for the transformation of Arabidopsis thaliana JOURNAL Biosci. Biotechnol. Biochem. 75 (4), 804-807 (2011) PUBMED 21512216 REFERENCE 2 (bases 1 to 12196) AUTHORS Tanaka Y, Nakagawa T. TITLE Direct Submission JOURNAL Submitted (12-JAN-2011) Contact:Tsuyoshi Nakagawa Shimane University, Center for Integrated Research in Science; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan REFERENCE 3 (bases 1 to 12196) TITLE Direct Submission REFERENCE 4 (bases 1 to 12196) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biosci. Biotechnol. Biochem."; date: "2011"; volume: "75"; issue: "4"; pages: "804-807" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-JAN-2011) Contact:Tsuyoshi Nakagawa Shimane University, Center for Integrated Research in Science; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT constructed using pPZP221. FEATURES Location/Qualifiers source 1..12196 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(54..78) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" primer_bind 281..297 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 812..1157 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" protein_bind 1179..1303 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 1340..1370 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 1424..2080 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 2425..2727 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(2771..2895) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS 2906..2938 /codon_start=1 /label=T7 tag (gene 10 leader) /note="leader peptide from bacteriophage T7 gene 10" /translation="MASMTGGQQMG" terminator 2960..3212 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" primer_bind complement(3246..3262) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 3270..3286 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3294..3324) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3339..3360) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." terminator complement(3396..3648) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(3686..4981) /codon_start=1 /gene="gpt" /product="UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P transferase" /label=gpt /protein_id="BAJ61235.1" /translation="MAARKRASSISIPNKPDPSEPNSAPSEQKMTRKTVSASGEEFRLA PPKLGVIFVISTLLCSLYLYLLCFHYKVDNELKRSILINAGLSLVGFFVTLKMIPVTAR YVLRRNMFGFDINKRGTPQGDIKVPESLGIVVGIVFLIVAIIFQYFNFTEDSNWLVEYN AALASICFMILLGFVDDVLDVPWRVKLVLPSFATLPLLMAYAGHTTIVIPKPLVAYIGL EVLNLGRIYKLYMGLLAVFCTNSINIHAGLNGLEIGQTVVIAAAILIHNVMQIGASVDP EYHQAHAFSIFLTQPLMATSLAMLAYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSET LLIFFLPQVLNLLLSLPQLAGIVKCPRHRLPRYDPATGLLTGTKDGTLVNVYLRLFGPK SEKSLCIHLLVFQALACAFCFILRHFLAGWYK" gene complement(3686..4981) /gene="gpt" /label=gpt promoter complement(5033..5212) /label=NOS promoter /note="nopaline synthase promoter" misc_feature complement(5718..5742) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 6263..7051 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 7300..7888 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(8074..8214) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(8558..8752) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(8821..9891) /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="VSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI LVMRYRNLIEGEASAGS" CDS complement(10323..10949) /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"
This page is informational only.