Basic Vector Information
- Vector Name:
- pGWB688
- Antibiotic Resistance:
- Streptomycin
- Length:
- 11423 bp
- Type:
- Gateway binary vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Momtaz S, Dutta A, Tanaka Y, Aboulela M, Nishimura K, Sugiura S, Niwa T, Maeo K, Goto-Yamada S, Kimura T, Ishiguro S, Mano S, Nakagawa T.
- Promoter:
- NOS
pGWB688 vector Map
pGWB688 vector Sequence
LOCUS 40924_23644 11423 bp DNA circular SYN 18-DEC-2018 DEFINITION Gateway binary vector pGWB688 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11423) AUTHORS Momtaz S, Dutta A, Tanaka Y, Aboulela M, Nishimura K, Sugiura S, Niwa T, Maeo K, Goto-Yamada S, Kimura T, Ishiguro S, Mano S, Nakagawa T. TITLE Gateway Binary Vectors with Organelle-Targeted Fluorescent Proteins for Highly Sensitive Reporter Assay in Gene Expression Analysis of Plants JOURNAL Unpublished REFERENCE 2 (bases 1 to 11423) AUTHORS Momtaz S, Dutta A, Tanaka Y, Aboulela M, Nishimura K, Sugiura S, Niwa T, Maeo K, Goto-Yamada S, Kimura T, Ishiguro S, Mano S, Nakagawa T. TITLE Direct Submission JOURNAL Submitted (17-OCT-2018) Contact:Tsuyoshi Nakagawa Shimane University, Interdisciplinary Center for Science Research; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan REFERENCE 3 (bases 1 to 11423) TITLE Direct Submission REFERENCE 4 (bases 1 to 11423) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-OCT-2018) Contact:Tsuyoshi Nakagawa Shimane University, Interdisciplinary Center for Science Research; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT constructed using pPZP221. FEATURES Location/Qualifiers source 1..11423 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(54..78) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" primer_bind 281..297 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 338..462 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 499..529 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 583..1239 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 1584..1886 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(1930..2054) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS 2065..2775 /codon_start=1 /label=TagRFP /note="monomeric derivative of red fluorescent protein from Entacmaea quadricolor (Merzlyak et al., 2007)" /translation="MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTM RIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGG VLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRSD MALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAV ARYCDLPSKLGHKLN" terminator 2809..3061 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" primer_bind complement(3095..3111) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 3119..3135 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3143..3173) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3188..3209) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." terminator complement(3245..3497) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(3660..4208) /codon_start=1 /label=BlpR /note="phosphinothricin acetyltransferase" /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF WQLDFSLPVPPRPVLPVTEI" promoter complement(4260..4439) /label=NOS promoter /note="nopaline synthase promoter" misc_feature complement(4945..4969) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 5490..6278 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 6527..7115 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(7301..7441) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(7785..7979) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(8048..9118) /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="VSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI LVMRYRNLIEGEASAGS" CDS complement(9550..10176) /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"
This page is informational only.