Basic Vector Information
- Vector Name:
- pGWB624
- Antibiotic Resistance:
- Streptomycin
- Length:
- 12221 bp
- Type:
- Gateway binary vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Nakamura S, Mano S, Tanaka Y, Ohnishi M, Nakamori C, Araki M, Niwa T, Nishimura M, Kaminaka H, Nakagawa T, Sato Y, Ishiguro S.
- Promoter:
- CaMV35S(long)
pGWB624 vector Map
pGWB624 vector Sequence
LOCUS 40924_23499 12221 bp DNA circular SYN 18-DEC-2018 DEFINITION Gateway binary vector pGWB624 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12221) AUTHORS Nakamura S, Mano S, Tanaka Y, Ohnishi M, Nakamori C, Araki M, Niwa T, Nishimura M, Kaminaka H, Nakagawa T, Sato Y, Ishiguro S. TITLE Gateway binary vectors with the bialaphos resistance gene, bar, as a selection marker for plant transformation JOURNAL Biosci. Biotechnol. Biochem. 74 (6), 1315-1319 (2010) PUBMED 20530878 REFERENCE 2 (bases 1 to 12221) AUTHORS Tanaka Y, Nakamura S, Ishiguro S, Nakagawa T. TITLE Direct Submission JOURNAL Submitted (22-JAN-2010) Contact:Tsuyoshi Nakagawa Shimane University, Center for Integrated Research in Science; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan REFERENCE 3 (bases 1 to 12221) TITLE Direct Submission REFERENCE 4 (bases 1 to 12221) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biosci. Biotechnol. Biochem."; date: "2010"; volume: "74"; issue: "6"; pages: "1315-1319" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-JAN-2010) Contact:Tsuyoshi Nakagawa Shimane University, Center for Integrated Research in Science; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT constructed using pPZP221. FEATURES Location/Qualifiers source 1..12221 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(54..78) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" primer_bind 281..297 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 812..1157 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" CDS 1178..1831 /codon_start=1 /label=GST /note="glutathione S-transferase from Schistosoma japonicum" /translation="MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKK FELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRY GVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVL YMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK" CDS 1838..1855 /codon_start=1 /label=thrombin site /note="thrombin recognition and cleavage site" /translation="LVPRGS" protein_bind 1865..1989 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 2026..2056 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 2110..2766 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 3111..3413 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(3457..3581) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" terminator 3607..3859 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" primer_bind complement(3893..3909) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 3917..3933 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3941..3971) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3986..4007) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." terminator complement(4043..4295) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(4458..5006) /codon_start=1 /label=BlpR /note="phosphinothricin acetyltransferase" /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF WQLDFSLPVPPRPVLPVTEI" promoter complement(5058..5237) /label=NOS promoter /note="nopaline synthase promoter" misc_feature complement(5743..5767) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 6288..7076 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 7325..7913 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(8099..8239) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(8583..8777) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(8846..9916) /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="VSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI LVMRYRNLIEGEASAGS" CDS complement(10348..10974) /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"
This page is informational only.