Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V005737 | pGWB611 | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
pGWB611 is a Gateway binary vector designed for plant transformation, featuring the bialaphos resistance gene (bar) as a selection marker for successful selection of transformed cells using BASTA® or glufosinate-ammonium. The vector contains the Pnos:bar:Tnos marker in reverse orientation relative to the cloned gene, providing compatibility with pGWB and R4pGWB vectors carrying kanamycin or hygromycin B resistance.
pGWB611 is part of a series of vectors that enable the creation of fusion constructs with various reporter genes and tags, facilitating transgenic experiments under standardized conditions.
- Vector Name:
- pGWB611
- Antibiotic Resistance:
- Streptomycin
- Length:
- 11565 bp
- Type:
- Gateway binary vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Nakamura S, Mano S, Tanaka Y, Ohnishi M, Nakamori C, Araki M, Niwa T, Nishimura M, Kaminaka H, Nakagawa T, Sato Y, Ishiguro S.
- Promoter:
- CaMV35S(long)
pGWB611 vector Vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Nakamura S, Mano S, Tanaka Y, Ohnishi M, Nakamori C, Araki M, Niwa T, Nishimura M, Kaminaka H, Nakagawa T, Sato Y, Ishiguro S. Gateway binary vectors with the bialaphos resistance gene, bar, as a selection marker for plant transformation. Biosci Biotechnol Biochem. 2010;74(6):1315-9.
pGWB611 vector Sequence
LOCUS 40924_23434 11565 bp DNA circular SYN 18-DEC-2018 DEFINITION Gateway binary vector pGWB611 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11565) AUTHORS Nakamura S, Mano S, Tanaka Y, Ohnishi M, Nakamori C, Araki M, Niwa T, Nishimura M, Kaminaka H, Nakagawa T, Sato Y, Ishiguro S. TITLE Gateway binary vectors with the bialaphos resistance gene, bar, as a selection marker for plant transformation JOURNAL Biosci. Biotechnol. Biochem. 74 (6), 1315-1319 (2010) PUBMED 20530878 REFERENCE 2 (bases 1 to 11565) AUTHORS Tanaka Y, Nakamura S, Ishiguro S, Nakagawa T. TITLE Direct Submission JOURNAL Submitted (22-JAN-2010) Contact:Tsuyoshi Nakagawa Shimane University, Center for Integrated Research in Science; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan REFERENCE 3 (bases 1 to 11565) TITLE Direct Submission REFERENCE 4 (bases 1 to 11565) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biosci. Biotechnol. Biochem."; date: "2010"; volume: "74"; issue: "6"; pages: "1315-1319" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-JAN-2010) Contact:Tsuyoshi Nakagawa Shimane University, Center for Integrated Research in Science; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT constructed using pPZP221. FEATURES Location/Qualifiers source 1..11565 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(54..78) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" primer_bind 281..297 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 812..1157 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" protein_bind 1179..1303 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 1340..1370 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 1424..2080 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 2425..2727 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(2771..2895) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS 2906..2929 /codon_start=1 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" /translation="DYKDDDDK" terminator 2951..3203 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" primer_bind complement(3237..3253) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 3261..3277 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3285..3315) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3330..3351) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." terminator complement(3387..3639) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(3802..4350) /codon_start=1 /label=BlpR /note="phosphinothricin acetyltransferase" /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF WQLDFSLPVPPRPVLPVTEI" promoter complement(4402..4581) /label=NOS promoter /note="nopaline synthase promoter" misc_feature complement(5087..5111) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 5632..6420 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 6669..7257 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(7443..7583) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(7927..8121) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(8190..9260) /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="VSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI LVMRYRNLIEGEASAGS" CDS complement(9692..10318) /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"