Basic Vector Information
- Vector Name:
- pGWB419
- Antibiotic Resistance:
- Streptomycin
- Length:
- 11231 bp
- Type:
- Gateway binary vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Nakagawa T, Suzuki T, Murata S, Nakamura S, Hino T, Maeo K, Tabata R, Kawai T, Tanaka K, Niwa Y, Watanabe Y, Nakamura K, Kimura T, Ishiguro S.
- Promoter:
- NOS
pGWB419 vector Map
pGWB419 vector Sequence
LOCUS 40924_22924 11231 bp DNA circular SYN 18-DEC-2018 DEFINITION Gateway binary vector pGWB419 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11231) AUTHORS Nakagawa T, Suzuki T, Murata S, Nakamura S, Hino T, Maeo K, Tabata R, Kawai T, Tanaka K, Niwa Y, Watanabe Y, Nakamura K, Kimura T, Ishiguro S. TITLE Improved Gateway Binary Vectors: High-Performance Vectors for Creation of Fusion Constructs in Transgenic Analysis of Plants JOURNAL Biosci. Biotechnol. Biochem. (2007) In press PUBMED 17690442 REFERENCE 2 (bases 1 to 11231) AUTHORS Nakagawa T, Ishiguro S. TITLE Direct Submission JOURNAL Submitted (21-FEB-2007) Tsuyoshi Nakagawa, Shimane University, Center for Integrated Research in Science; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan (E-mail:tnakagaw@life.shimane-u.ac.jp, Tel:81-852-32-6595, Fax:81-852-32-6109) REFERENCE 3 (bases 1 to 11231) TITLE Direct Submission REFERENCE 4 (bases 1 to 11231) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biosci. Biotechnol. Biochem. (2007) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-FEB-2007) Tsuyoshi Nakagawa, Shimane University, Center for Integrated Research in Science"; volume: " 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan (E-mail:tnakagaw@life.shimane-u.ac.jp, Tel:81-852-32-6595, Fax"; pages: "81-852-32-6109" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT constructed using pPZP221. FEATURES Location/Qualifiers source 1..11231 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(54..78) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" primer_bind 281..297 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 323..447 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 484..514 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 568..1224 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 1569..1871 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(1915..2039) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS 2065..2094 /codon_start=1 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" /translation="EQKLISEEDL" CDS 2101..2130 /codon_start=1 /product="Myc (human c-Myc proto-oncogene) epitope tag" /label=Myc /translation="EQKLISEEDL" CDS 2146..2175 /codon_start=1 /product="Myc (human c-Myc proto-oncogene) epitope tag" /label=Myc /translation="EQKLISEEDL" CDS 2182..2211 /codon_start=1 /product="Myc (human c-Myc proto-oncogene) epitope tag" /label=Myc /translation="EQKLISEEDL" CDS 2218..2247 /codon_start=1 /product="Myc (human c-Myc proto-oncogene) epitope tag" /label=Myc /translation="EQKLISEEDL" CDS 2263..2292 /codon_start=1 /product="Myc (human c-Myc proto-oncogene) epitope tag" /label=Myc /translation="EQKLISEEDL" CDS 2299..2328 /codon_start=1 /product="Myc (human c-Myc proto-oncogene) epitope tag" /label=Myc /translation="EQKLISEEDL" CDS 2335..2364 /codon_start=1 /product="Myc (human c-Myc proto-oncogene) epitope tag" /label=Myc /translation="EQKLISEEDL" CDS 2380..2409 /codon_start=1 /product="Myc (human c-Myc proto-oncogene) epitope tag" /label=Myc /translation="EQKLISEEDL" CDS 2416..2445 /codon_start=1 /product="Myc (human c-Myc proto-oncogene) epitope tag" /label=Myc /translation="EQKLISEEDL" terminator 2473..2725 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" primer_bind complement(2759..2775) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 2783..2799 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2807..2837) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2852..2873) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." terminator complement(2907..3159) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(3552..4340) /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase from Tn5" /translation="IEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRPV LFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLSS HLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQG LAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIAL ATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" promoter complement(4364..4547) /label=NOS promoter /note="nopaline synthase promoter" misc_feature complement(4753..4777) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 5298..6086 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 6335..6923 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(7109..7249) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(7593..7787) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(7856..8926) /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="VSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI LVMRYRNLIEGEASAGS" CDS complement(9358..9984) /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"
This page is informational only.