Basic Vector Information
- Vector Name:
- pGV4112
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3792 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Broeders S, De Greve H, De Rycke R, Bauw G, Jansens S, Buys L, Smagghe G, Ripoll C, Peumans WJ, Van Damme EJM., Hernalsteens JP.
- Promoter:
- CaMV 35S
pGV4112 vector Map
pGV4112 vector Sequence
LOCUS 40924_22819 3792 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pGV4112 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3792) AUTHORS Broeders S, De Greve H, De Rycke R, Bauw G, Jansens S, Buys L, Smagghe G, Ripoll C, Peumans WJ, Van Damme EJM., Hernalsteens JP. TITLE Leaf and bulb lectins from garlic (Allium sativum L.) are expressed, correctly processed and targeted to the cytoplasm in transgenic tobacco plants JOURNAL Unpublished REFERENCE 2 (bases 1 to 3792) AUTHORS De Greve H. TITLE Direct Submission JOURNAL Submitted (27-SEP-2001) De Greve H., Genetische Virologie, Vrije Universiteit Brussel, Paardenstraat 65, Sint-Genesius-Rode, B-1640, BELGIUM REFERENCE 3 (bases 1 to 3792) TITLE Direct Submission REFERENCE 4 (bases 1 to 3792) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-SEP-2001) De Greve H., Genetische Virologie, Vrije Universiteit Brussel, Paardenstraat 65, Sint-Genesius-Rode, B-1640, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3792 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 910..1255 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" misc_feature 1264..1290 /label=multiple cloning site /note="multiple cloning site" terminator 1301..1553 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" primer_bind complement(1571..1587) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1595..1611) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1619..1649) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1664..1685) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1973..2561) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2735..3592) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(3593..3697) /label=AmpR promoter
This page is informational only.