Basic Vector Information
- Vector Name:
- pGT2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3267 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Park HK, Zeng C.
pGT2 vector Map
pGT2 vector Sequence
LOCUS 40924_22779 3267 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pGT2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3267) AUTHORS Park HK, Zeng C. TITLE Construction of an XcmI-generated T vector bearing green fluorescent protein marker for direct cloning of PCR products JOURNAL Anal. Biochem. 360 (1), 144-145 (2007) PUBMED 17113027 REFERENCE 2 (bases 1 to 3267) AUTHORS Park HK, Zeng C. TITLE Direct Submission JOURNAL Submitted (22-SEP-2006) Bio. Sci., Univ. of Wisconsin-Milwaukee, 3209 N. Maryland Ave., Milwaukee, WI 53211, USA REFERENCE 3 (bases 1 to 3267) TITLE Direct Submission REFERENCE 4 (bases 1 to 3267) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Anal. Biochem."; date: "2007"; volume: "360"; issue: "1"; pages: "144-145" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-SEP-2006) Bio. Sci., Univ. of Wisconsin-Milwaukee, 3209 N. Maryland Ave., Milwaukee, WI 53211, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3267 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 52..73 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 88..118 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 126..142 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 150..166 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 214..228 /gene="gfpuv4-2aa" /label=XcmI restriction site #1 /note="XcmI restriction site #1" CDS 234..947 /codon_start=1 /label=GFPuv /note="GFP variant optimized for excitation by UV light" /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKA NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALLKDPNEKRDHMVLLE FVTAAGITHGMDELYK" misc_feature 948..962 /label=XcmI restriction site #2 /note="XcmI restriction site #2" promoter 1076..1180 /label=AmpR promoter CDS 1181..2038 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 2212..2800 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2986..3126) /label=bom /note="basis of mobility region from pBR322"
This page is informational only.