Basic Vector Information
- Vector Name:
- pGST-parallel1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5037 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Sheffield P, Garrard S, Derewenda Z.
pGST-parallel1 vector Map
pGST-parallel1 vector Sequence
LOCUS 40924_22769 5037 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pGST-parallel1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5037) AUTHORS Sheffield P, Garrard S, Derewenda Z. TITLE Overcoming expression and purification problems of RhoGDI using a family of 'parallel' expression vectors JOURNAL Protein Expr. Purif. 15 (1), 34-39 (1999) PUBMED 10024467 REFERENCE 2 (bases 1 to 5037) AUTHORS Sheffield PJ, Garrard SM, Derewenda ZS. TITLE Direct Submission JOURNAL Submitted (05-OCT-1998) Molecular Physiology and Biological Physics, University of Virginia, 4215 Jordan Hall, 1300 Jefferson Park Avenue, Charlottesville, Virginia 22908, USA REFERENCE 3 (bases 1 to 5037) TITLE Direct Submission REFERENCE 4 (bases 1 to 5037) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Protein Expr. Purif."; date: "1999"; volume: "15"; issue: "1"; pages: "34-39" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-OCT-1998) Molecular Physiology and Biological Physics, University of Virginia, 4215 Jordan Hall, 1300 Jefferson Park Avenue, Charlottesville, Virginia 22908, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5037 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 183..211 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 219..235 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 258..911 /codon_start=1 /label=GST /note="glutathione S-transferase from Schistosoma japonicum" /translation="MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKK FELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRY GVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVL YMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK" CDS 924..944 /codon_start=1 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" /translation="ENLYFQG" misc_feature 946..1034 /label=multiple cloning site /note="multiple cloning site" promoter 1340..1444 /label=AmpR promoter CDS 1445..2302 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 2476..3064 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 3308..3385 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 3386..4465 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 4481..4502 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 4517..4547 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 4555..4571 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 4591..4764 /codon_start=1 /label=lacZ-alpha /note="LacZ-alpha fragment of beta-galactosidase" /translation="MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART DRPSQQLRSLNGE"
This page is informational only.