pGSCZSOD32 vector (V005872)

Download GeneBank File(.gb)

LOCUS       40924_22759       13389 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Plant expression vector pGSCZSOD32, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 13389)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 13389)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 13389)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 13389)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 
            9052, BELGIUM"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..13389
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        72..102
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     protein_bind    110..126
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        227..407
                     /label=NOS promoter
                     /note="nopaline synthase promoter"
     CDS             456..1244
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     terminator      1421..2127
                     /label=OCS terminator
                     /note="octopine synthase terminator"
     misc_feature    complement(2318..2342)
                     /label=LB T-DNA repeat
                     /note="left border repeat from octopine Ach5 T-DNA"
     CDS             complement(2903..3691)
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     CDS             5594..6220
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             6657..7721
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      7790..7984
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     misc_feature    8328..8468
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(8654..9242)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(9557..9581)
                     /label=RB T-DNA repeat
                     /note="right border repeat from octopine Ach5 T-DNA"
     primer_bind     9678..9694
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     terminator      complement(9731..10437)
                     /label=OCS terminator
                     /note="octopine synthase terminator"
     CDS             complement(10494..12302)
                     /codon_start=1
                     /note="unnamed protein product; gus"
                     /protein_id="SJL87347.1"
                     /translation="MVRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAI
                     AVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEV
                     MEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHD
                     FFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQ
                     VVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQF
                     LINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDW
                     ADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARD
                     KNHPSVVMWSIANEPDTRPQVHGNISPLAEATRKLDPTRPITCVNVMFCDAHTDTISDL
                     FDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYT
                     DMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKP
                     KSAAFLLQKRWTGMNFGEKPQQGGKQ"
     regulatory      complement(12308..13208)
                     /label=CuZnSOD
                     /note="CuZnSOD"
                     /regulatory_class="promoter"
     primer_bind     complement(13224..13240)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    13248..13264
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(13272..13302)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(13317..13338)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."