Basic Vector Information
- Vector Name:
- pGSC05
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3621 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Talwar D, Gupta PS, Sidharth R, Radha KA, Radhakrishnan S.
- Promoter:
- araBAD
pGSC05 vector Map
pGSC05 vector Sequence
LOCUS 40924_22739 3621 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pGSC05, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3621) AUTHORS Talwar D, Gupta PS, Sidharth R, Radha KA, Radhakrishnan S. TITLE Novel gene cloning vectors with specific features JOURNAL Unpublished REFERENCE 2 (bases 1 to 3621) AUTHORS Talwar D, Gupta PS, Sidharth R, Radha KA, Radhakrishnan S. TITLE Direct Submission JOURNAL Submitted (26-MAR-2008) R REFERENCE 3 (bases 1 to 3621) TITLE Direct Submission REFERENCE 4 (bases 1 to 3621) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-MAR-2008) R" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3621 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(460..1176) /codon_start=1 /label=Cycle 3 GFP /note="Cycle 3 GFP (Crameri et al., 1996)" /translation="MASKGEELVPGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK ANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITHGMDELYK" RBS complement(1184..1206) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" promoter complement(1233..1398) /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" primer_bind complement(1451..1467) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1475..1491) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1499..1529) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1544..1565) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1853..2441) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2627..3418) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" promoter complement(3426..3526) /label=AmpR promoter
This page is informational only.