pLL3.7m-Clover-Geminin(1-110)-IRES-mKO2-Cdt(30-120) vector (V012513)

Price Information

Cat No. Plasmid Name Availability Add to cart
V012513 pLL3.7m-Clover-Geminin(1-110)-IRES-mKO2-Cdt(30-120) In stock, 1 week for quality controls

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
pLL3.7m-Clover-Geminin(1-110)-IRES-mKO2-Cdt(30-120)
Antibiotic Resistance:
Ampicillin
Length:
9033 bp
Type:
Mammalian Expression, Lentiviral
Replication origin:
ori
Copy Number:
High Copy
Promoter:
CMV
Cloning Method:
Restriction Enzyme
5' Primer:
agctggtttagtgaaccgtcagatc
3' Primer:
ggaaccggaacccttaaaca

pLL3.7m-Clover-Geminin(1-110)-IRES-mKO2-Cdt(30-120) vector Vector Map

pLL3.7m-Clover-Geminin(1-110)-IRES-mKO2-Cdt(30-120)9033 bp40080012001600200024002800320036004000440048005200560060006400680072007600800084008800CMV enhancerCMV promoter5' LTR (truncated)HIV-1 PsiRREgp41 peptideProtein TatcPPT/CTSU6 promoterKS primerloxPCMV enhancerCMV promoterCloverGem1 (1-110)IRES2mKO2Cdt1 (30-120)loxPWPREKS primer5' LTR (truncated)oriAmpRAmpR promoter

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pLL3.7m-Clover-Geminin(1-110)-IRES-mKO2-Cdt(30-120) vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       V012513                 9033 bp    DNA     circular SYN 13-MAY-2021
DEFINITION  Exported.
ACCESSION   V012513
VERSION     V012513
KEYWORDS    pLL3.7m-Clover-Geminin(1-110)-IRES-mKO2-Cdt(30-120)
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 9033)
  AUTHORS   Bajar BT, Lam AJ, Badiee RK, Oh YH, Chu J, Zhou XX, Kim N, Kim BB,
            Chung M, Yablonovitch AL, Cruz BF, Kulalert K, Tao JJ, Meyer T, Su
            XD, Lin MZ
  TITLE     Fluorescent indicators for simultaneous reporting of all four cell
            cycle phases.
  JOURNAL   Nat Methods. 2016 Oct 31. doi: 10.1038/nmeth.4045.
   PUBMED   27798610
REFERENCE   2  (bases 1 to 9033)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 9033)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat
            Methods. 2016 Oct 31. doi: 10.1038/nmeth.4045."
            SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9033
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        63..366
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        368..566
                     /label="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     LTR             584..764
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     misc_feature    811..936
                     /label="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus
                     type 1"
     misc_feature    1433..1666
                     /label="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for
                     Rev-dependent mRNA export from the nucleus to the
                     cytoplasm."
     CDS             1851..1895
                     /label="gp41 peptide"
                     /note="antigenic peptide corresponding to amino acids 655
                     to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
                     al., 2013)"
     CDS             2044..2085
                     /note="Protein Tat from Human immunodeficiency virus type 1
                     group M subtype B (isolate WMJ22). Accession#: P12509"
                     /label="Protein Tat"
     misc_feature    2193..2310
                     /label="cPPT/CTS"
                     /note="central polypurine tract and central termination
                     sequence of HIV-1"
     promoter        2369..2681
                     /label="U6 promoter"
                     /note="RNA polymerase III promoter for mouse U6 snRNA (Das
                     et al., 1988)"
     primer_bind     2698..2714
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    2756..2789
                     /label="loxP"
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core
                     sequence (GCATACAT)."
     enhancer        2905..3208
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        3209..3412
                     /label="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     CDS             3444..4160
                     /label="Clover"
                     /note="bright green-yellow fluorescent protein derived from
                     GFP (Lam et al., 2012)"
     CDS             4191..4520
                     /codon_start=1
                     /product="degron consisting of residues 1-110 of human
                     Geminin (Zielke and Edgar, 2015)"
                     /label="Gem1 (1-110)"
                     /translation="MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELS
                     AGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAE
                     KRRKAL"
     misc_feature    4525..5105
                     /label="IRES2"
                     /note="internal ribosome entry site (IRES) of the
                     encephalomyocarditis virus (EMCV)"
     CDS             5112..5762
                     /label="mKO2"
                     /note="monomeric Kusabira-Orange 2 fluorescent protein"
     CDS             5817..6089
                     /label="Cdt1 (30-120)"
                     /note="degron consisting of residues 30-120 of human Cdt1
                     (Zielke and Edgar, 2015)"
     protein_bind    complement(6120..6153)
                     /label="loxP"
                     /note="Cre-mediated recombination occurs in the 8-bp core
                     sequence (ATGTATGC) (Shaw et al., 2021)."
     misc_feature    6209..6797
                     /label="WPRE"
                     /note="woodchuck hepatitis virus posttranscriptional
                     regulatory element"
     primer_bind     complement(6800..6816)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     LTR             7039..7219
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     rep_origin      complement(7281..7869)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(8043..8900)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(8901..9005)
                     /label="AmpR promoter"