Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V012513 | pLL3.7m-Clover-Geminin(1-110)-IRES-mKO2-Cdt(30-120) | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pLL3.7m-Clover-Geminin(1-110)-IRES-mKO2-Cdt(30-120)
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9033 bp
- Type:
- Mammalian Expression, Lentiviral
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- CMV
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- agctggtttagtgaaccgtcagatc
- 3' Primer:
- ggaaccggaacccttaaaca
pLL3.7m-Clover-Geminin(1-110)-IRES-mKO2-Cdt(30-120) vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pLL3.7m-Clover-Geminin(1-110)-IRES-mKO2-Cdt(30-120) vector Sequence
LOCUS V012513 9033 bp DNA circular SYN 13-MAY-2021 DEFINITION Exported. ACCESSION V012513 VERSION V012513 KEYWORDS pLL3.7m-Clover-Geminin(1-110)-IRES-mKO2-Cdt(30-120) SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9033) AUTHORS Bajar BT, Lam AJ, Badiee RK, Oh YH, Chu J, Zhou XX, Kim N, Kim BB, Chung M, Yablonovitch AL, Cruz BF, Kulalert K, Tao JJ, Meyer T, Su XD, Lin MZ TITLE Fluorescent indicators for simultaneous reporting of all four cell cycle phases. JOURNAL Nat Methods. 2016 Oct 31. doi: 10.1038/nmeth.4045. PUBMED 27798610 REFERENCE 2 (bases 1 to 9033) TITLE Direct Submission REFERENCE 3 (bases 1 to 9033) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Methods. 2016 Oct 31. doi: 10.1038/nmeth.4045." SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..9033 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 63..366 /label="CMV enhancer" /note="human cytomegalovirus immediate early enhancer" promoter 368..566 /label="CMV promoter" /note="human cytomegalovirus (CMV) immediate early promoter" LTR 584..764 /label="5' LTR (truncated)" /note="truncated 5' long terminal repeat (LTR) from HIV-1" misc_feature 811..936 /label="HIV-1 Psi" /note="packaging signal of human immunodeficiency virus type 1" misc_feature 1433..1666 /label="RRE" /note="The Rev response element (RRE) of HIV-1 allows for Rev-dependent mRNA export from the nucleus to the cytoplasm." CDS 1851..1895 /label="gp41 peptide" /note="antigenic peptide corresponding to amino acids 655 to 669 of the HIV envelope protein gp41 (Lutje Hulsik et al., 2013)" CDS 2044..2085 /note="Protein Tat from Human immunodeficiency virus type 1 group M subtype B (isolate WMJ22). Accession#: P12509" /label="Protein Tat" misc_feature 2193..2310 /label="cPPT/CTS" /note="central polypurine tract and central termination sequence of HIV-1" promoter 2369..2681 /label="U6 promoter" /note="RNA polymerase III promoter for mouse U6 snRNA (Das et al., 1988)" primer_bind 2698..2714 /label="KS primer" /note="common sequencing primer, one of multiple similar variants" protein_bind 2756..2789 /label="loxP" /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." enhancer 2905..3208 /label="CMV enhancer" /note="human cytomegalovirus immediate early enhancer" promoter 3209..3412 /label="CMV promoter" /note="human cytomegalovirus (CMV) immediate early promoter" CDS 3444..4160 /label="Clover" /note="bright green-yellow fluorescent protein derived from GFP (Lam et al., 2012)" CDS 4191..4520 /codon_start=1 /product="degron consisting of residues 1-110 of human Geminin (Zielke and Edgar, 2015)" /label="Gem1 (1-110)" /translation="MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELS AGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAE KRRKAL" misc_feature 4525..5105 /label="IRES2" /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 5112..5762 /label="mKO2" /note="monomeric Kusabira-Orange 2 fluorescent protein" CDS 5817..6089 /label="Cdt1 (30-120)" /note="degron consisting of residues 30-120 of human Cdt1 (Zielke and Edgar, 2015)" protein_bind complement(6120..6153) /label="loxP" /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." misc_feature 6209..6797 /label="WPRE" /note="woodchuck hepatitis virus posttranscriptional regulatory element" primer_bind complement(6800..6816) /label="KS primer" /note="common sequencing primer, one of multiple similar variants" LTR 7039..7219 /label="5' LTR (truncated)" /note="truncated 5' long terminal repeat (LTR) from HIV-1" rep_origin complement(7281..7869) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8043..8900) /label="AmpR" /note="beta-lactamase" promoter complement(8901..9005) /label="AmpR promoter"