Basic Vector Information
- Vector Name:
- pGR8
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9655 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Mazzarella R, Pilia G.
- Promoter:
- LYS2
pGR8 vector Map
pGR8 vector Sequence
LOCUS 40924_22543 9655 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pGR8, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9655) AUTHORS Mazzarella R, Pilia G. TITLE Recombination trapping: an 'in vivo' approach to recover cDNAs encoded in YACs JOURNAL Unpublished REFERENCE 2 (bases 1 to 9655) TITLE Direct Submission REFERENCE 3 (bases 1 to 9655) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article" COMMENT GSDB:S:1274444. FEATURES Location/Qualifiers source 1..9655 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..135 /standard_name="telomere" /label=telomere prim_transcript 145..2097 /gene="HIS5" gene 145..2097 /gene="HIS5" /label=HIS5 CDS 761..1915 /codon_start=1 /gene="HIS5" /product="histidinol phosphate aminotransferase" /EC_number="2.6.1.9" /label=HIS5 /protein_id="AAB68950.1" /translation="MVFDLKRIVRPKIYNLEPYRCARDDFTEGILLDANENAHGPTPVE LSKTNLHRYPDPHQLEFKTAMTKYRNKTSSYANDPEVKPLTADNLCLGVGSDESIDAII RACCVREEKILVLPPTYSMSSVCANINDIEVVQCPLIVSDGSFQMDTEAVLTILKNDSL IKLMFVTSPGNPTGAKIKTSLIEKVLQNWDNGLVVVDEAYVDFCGGSTAPLVTKYPNLV TLQTLSKSFGLAGIRLGMTYATAELARILNAMKAPYNISSLASEYALKAVQDSNLKKME ATSKIINEEKMLLLKELTALDYVDDQYVGGLDANFLLIRINGGDNVLAKKLYYQLATQS GVVVRFRGNELGCSGCLRITVGTHEENTHLIKYFKETLYKLANE" promoter complement(2100..2118) /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" promoter 2136..2373 /label=LYS2 promoter CDS 2374..6549 /label=LYS2 /note="alpha-aminoadipate reductase, required for lysine biosynthesis" rep_origin complement(6719..7147) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 7289..7305 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 7312..7330 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 7339..7446 /label=MCS /note="pBluescript multiple cloning site" promoter complement(7459..7477) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(7498..7514) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(7522..7538) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(7546..7576) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(7591..7612) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(7900..8488) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8662..9519) /label=AmpR /note="beta-lactamase" promoter complement(9520..9624) /label=AmpR promoter
This page is informational only.