pGPI-SceI-XErm vector (V005911)

Download GeneBank File(.gb)

LOCUS       V005911                 6376 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V005911
VERSION     V005911
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6376)
  AUTHORS   Yero D, Ferrer-Navarro M, Costenaro L, Planell R, Conchillo-Sole O,
            Sole M, Roca I, Gibert I, Daura X.
  TITLE     A transport system associated with the intrinsic antimicrobial
            multiresistance in Pseudomonas aeruginosa
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6376)
  AUTHORS   Yero D, Gibert I.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2016) Genetica Molecular Bacteriana, Institut de
            Biotecnologia i de Biomedicina (IBB), Campus UAB, Bellaterra,
            Barcelona 08191, Spain
REFERENCE   3  (bases 1 to 6376)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6376)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (20-DEC-2016) Genetica Molecular Bacteriana, Institut de
            Biotecnologia i de Biomedicina (IBB), Campus UAB, Bellaterra,
            Barcelona 08191, Spain"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6376
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     oriT            625..734
                     /label="oriT"
                     /note="incP origin of transfer"
     CDS             767..1135
                     /label="traJ"
                     /note="oriT-recognizing protein"
     CDS             complement(1101..1526)
                     /codon_start=1
                     /gene="traI"
                     /product="TraI"
                     /label="traI"
                     /protein_id="ATW75324.1"
                     /translation="MNVQVVGVVMHGTDALMLGEAKPSADAVLNRAQRLRVGLLSRAEA
                     NQQVIGLVGLGTGVAVLGRHHLGHDSGQGVCLAVRDAHVTQALGLALLVGDVLHQLREV
                     ALLDGAHGDVLGNHAHPPAVLAAKKVMALPSGGPRPS"
     gene            complement(1101..1526)
                     /gene="traI"
                     /label="traI"
     rep_origin      1756..2144
                     /label="R6K gamma ori"
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     misc_feature    2149..2177
                     /label="multiple cloning site 1"
                     /note="multiple cloning site 1"
     promoter        2193..2221
                     /label="tac promoter"
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     CDS             2253..3173
                     /gene="xylE"
                     /label="Metapyrocatechase"
                     /note="Metapyrocatechase from Pseudomonas putida.
                     Accession#: P06622"
     misc_feature    3182..3215
                     /label="multiple cloning site 2"
                     /note="multiple cloning site 2"
     CDS             3939..4172
                     /label="TpR"
                     /note="E. coli plasmid-associated dihydrofolate reductase"
     misc_feature    4178..4195
                     /label="I-SceI recognition site"
                     /note="I-SceI recognition site"
     CDS             4582..5316
                     /gene="ermBP"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis. Accession#: P0A4D5"