Basic Vector Information
- Vector Name:
- pGPI-SceI-XCm
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 6601 bp
- Type:
- Suicide vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Hamad MA, Skeldon AM, Valvano MA.
pGPI-SceI-XCm vector Vector Map
pGPI-SceI-XCm vector Sequence
LOCUS V005912 6601 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005912 VERSION V005912 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6601) AUTHORS Hamad MA, Skeldon AM, Valvano MA. TITLE Construction of aminoglycoside-sensitive Burkholderia cenocepacia strains for use in studies of intracellular bacteria with the gentamicin protection assay JOURNAL Appl. Environ. Microbiol. 76 (10), 3170-3176 (2010) PUBMED 20348312 REFERENCE 2 (bases 1 to 6601) AUTHORS Hamad MA, Skeldon AM, Valvano MA. TITLE Direct Submission JOURNAL Submitted (21-DEC-2012) Microbiology and Immunology, Western University, 1151 Richmond Street North, London, Ontario N6A 5C1, Canada REFERENCE 3 (bases 1 to 6601) TITLE Direct Submission REFERENCE 4 (bases 1 to 6601) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2010"; volume: "76"; issue: "10"; pages: "3170-3176" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-DEC-2012) Microbiology and Immunology, Western University, 1151 Richmond Street North, London, Ontario N6A 5C1, Canada" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6601 /mol_type="other DNA" /organism="synthetic DNA construct" oriT 626..735 /label="oriT" /note="incP origin of transfer" CDS 768..1136 /label="traJ" /note="oriT-recognizing protein" CDS complement(1102..1527) /codon_start=1 /product="TraI" /label="TraI" /protein_id="AGC79933.1" /translation="MNVQVVGVVMHGTDALMLGEAKPSADAVLNRAQRLRVGLLSRAEA NQQVIGLVGLGTGVAVLGRHHLGHDSGQGVCLAVRDAHVTQALGLALLVGDVLHQLREV ALLDGAHGDVLGNHAHPPAVLAAKKVMALPSGGPRPS" rep_origin 1757..2145 /label="R6K gamma ori" /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" misc_feature 2150..2178 /label="multiple cloning site 1" /note="multiple cloning site 1" promoter 2194..2222 /label="tac promoter" /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" CDS 2254..3174 /gene="xylE" /label="Metapyrocatechase" /note="Metapyrocatechase from Pseudomonas putida. Accession#: P06622" misc_feature 3183..3216 /label="multiple cloning site 2" /note="multiple cloning site 2" promoter 3945..3973 /label="Pc promoter" /note="class 1 integron promoter" CDS 4299..4532 /label="TpR" /note="E. coli plasmid-associated dihydrofolate reductase" misc_feature 4538..4555 /label="I-SceI recognition site" /note="I-SceI recognition site" promoter 4927..5029 /label="cat promoter" /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 5030..5668 /codon_start=1 /product="chloramphenicol acetyltransferase" /function="chloramphenicol resistance" /label="chloramphenicol acetyltransferase" /protein_id="AGC79930.1" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRCLMNTTVLR"
This page is informational only.