Basic Vector Information
- Vector Name:
- pGP-Lenti3
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6818 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Bhat KS.
- Promoter:
- RSV
pGP-Lenti3 vector Map
pGP-Lenti3 vector Sequence
LOCUS V005917 6818 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005917 VERSION V005917 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6818) AUTHORS Bhat KS. TITLE A lentiviral plasmid cloning vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 6818) AUTHORS Bhat KS. TITLE Direct Submission JOURNAL Submitted (24-SEP-2012) Gene PASS Inc., 4711 Trousdale Drive, Nashville, TN 37220, USA REFERENCE 3 (bases 1 to 6818) TITLE Direct Submission REFERENCE 4 (bases 1 to 6818) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-SEP-2012) Gene PASS Inc., 4711 Trousdale Drive, Nashville, TN 37220, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6818 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 6..233 /label="RSV promoter" /note="Rous sarcoma virus enhancer/promoter" LTR 234..414 /label="5' LTR (truncated)" /note="truncated 5' long terminal repeat (LTR) from HIV-1" misc_feature 458..583 /label="HIV-1 Psi" /note="packaging signal of human immunodeficiency virus type 1" misc_feature 1076..1309 /label="RRE" /note="The Rev response element (RRE) of HIV-1 allows for Rev-dependent mRNA export from the nucleus to the cytoplasm." CDS 1493..1537 /label="gp41 peptide" /note="antigenic peptide corresponding to amino acids 655 to 669 of the HIV envelope protein gp41 (Lutje Hulsik et al., 2013)" CDS 1686..1727 /note="Protein Tat from Human immunodeficiency virus type 1 group M subtype B (isolate WMJ22). Accession#: P12509" /label="Protein Tat" misc_feature 1804..1921 /label="cPPT/CTS" /note="central polypurine tract and central termination sequence of HIV-1" promoter 2011..2214 /label="CMV promoter" /note="human cytomegalovirus (CMV) immediate early promoter" promoter 2313..2524 /label="EF-1-alpha core promoter" /note="core promoter for human elongation factor EF-1-alpha" CDS 2529..3245 /label="EGFP" /note="enhanced GFP" CDS 3252..3305 /codon_start=1 /product="2A peptide from Thosea asigna virus capsid protein" /label="T2A" /note="Eukaryotic ribosomes fail to insert a peptide bond between the Gly and Pro residues, yielding separate polypeptides." /translation="EGRGSLLTCGDVEENPGP" CDS 3306..3905 /codon_start=1 /gene="pac from Streptomyces alboniger" /product="puromycin N-acetyltransferase" /label="PuroR" /note="confers resistance to puromycin" /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA" misc_feature 3906..4493 /label="WPRE" /note="woodchuck hepatitis virus posttranscriptional regulatory element" LTR 4567..4800 /label="3' LTR (Delta-U3)" /note="self-inactivating 3' long terminal repeat (LTR) from HIV-1" polyA_signal 4872..5006 /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" rep_origin 5012..5147 /label="SV40 ori" /note="SV40 origin of replication" rep_origin complement(5198..5781) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5905..6696) /label="NeoR/KanR" /note="aminoglycoside phosphotransferase" promoter complement(6697..6801) /label="AmpR promoter"
This page is informational only.