Basic Vector Information
- Vector Name:
- pGGZ003
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4114 bp
- Type:
- Cloning vector
- Replication origin:
- pSa ori
- Source/Author:
- Lampropoulos A, Sutikovic Z, Wenzl C, Maegele I, Lohmann JU, Forner J.
pGGZ003 vector Vector Map
pGGZ003 vector Sequence
LOCUS 40924_21868 4114 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pGGZ003, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4114) AUTHORS Lampropoulos A, Sutikovic Z, Wenzl C, Maegele I, Lohmann JU, Forner J. TITLE GreenGate - A Novel, Versatile, and Efficient Cloning System for Plant Transgenesis JOURNAL PLoS ONE 8 (12), E83043 (2013) PUBMED 24376629 REFERENCE 2 (bases 1 to 4114) AUTHORS Forner J. TITLE Direct Submission JOURNAL Submitted (28-SEP-2013) Centre for Organismal Studies, Ruprecht-Karls-Universitaet Heidelberg, Im Neuenheimer Feld 230, Heidelberg D-69221, Germany REFERENCE 3 (bases 1 to 4114) TITLE Direct Submission REFERENCE 4 (bases 1 to 4114) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2013"; volume: "8"; issue: "12"; pages: "E83043" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-SEP-2013) Centre for Organismal Studies, Ruprecht-Karls-Universitaet Heidelberg, Im Neuenheimer Feld 230, Heidelberg D-69221, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4114 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 26..515 /note="for replication in Agrobacterium tumefaciens; pSa origin of replication" misc_feature 534..556 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA (truncated)" misc_feature complement(607..612) /label=BsaI recognition site /note="BsaI recognition site" CDS 743..1399 /label=CmR /note="chloramphenicol acetyltransferase" CDS 1421..1723 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" CDS 1745..1996 /codon_start=1 /gene="lacZ alpha" /product="beta-galactosidase alpha peptide" /label=lacZ alpha /protein_id="AHE38489.1" /translation="MLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ LRSLNGEWRLMRYFLLTHLCGISHRIWCTLSTICSDAA" gene 1745..1996 /gene="lacZ alpha" /label=lacZ alpha misc_feature 2040..2045 /label=BsaI recognition site /note="BsaI recognition site" misc_feature 2133..2157 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" rep_origin complement(2248..2836) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3007..3795) /codon_start=1 /gene="aadA" /product="aminoglycoside adenyltransferase A" /label=aadA /protein_id="AHE38486.1" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" gene complement(3007..3795) /gene="aadA" /label=aadA rep_origin 4086..4114 /label=pSa ori /note="origin of replication from bacterial plasmid pSa"
This page is informational only.