Basic Vector Information
- Vector Name:
- pGFPTA
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3249 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Ito Y, Suzuki M, Husimi Y.
pGFPTA vector Vector Map
pGFPTA vector Sequence
LOCUS 40924_21618 3249 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pGFPTA DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3249) AUTHORS Ito Y, Suzuki M, Husimi Y. TITLE A T-extended vector using a green fluorescent protein as an indicator JOURNAL Gene 245 (1), 59-63 (2000) PUBMED 10713445 REFERENCE 2 (bases 1 to 3249) AUTHORS Ito Y, Suzuki M, Husimi Y. TITLE Direct Submission JOURNAL Submitted (07-FEB-2000) Yuzuru Husimi, Saitama University, Deptartment of Functional Materials Science; 255 Shimo-ookubo, Urawa, Saitama 338-8750, Japan (E-mail:ito@evolve.fms.saitama-u.ac.jp, Tel:+81-48-858-3531, Fax:+81-48-858-3531) REFERENCE 3 (bases 1 to 3249) TITLE Direct Submission REFERENCE 4 (bases 1 to 3249) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; date: "2000"; volume: "245"; issue: "1"; pages: "59-63" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (07-FEB-2000) Yuzuru Husimi, Saitama University, Deptartment of Functional Materials Science"; volume: " 255 Shimo-ookubo, Urawa, Saitama 338-8750, Japan (E-mail:ito@evolve.fms.saitama-u.ac.jp, Tel:+81-48-858-3531, Fax"; pages: "+81-48-858-3531" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3249 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 52..73 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 88..118 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 126..142 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 150..166 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 234..947 /codon_start=1 /label=GFPuv /note="GFP variant optimized for excitation by UV light" /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKA NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALLKDPNEKRDHMVLLE FVTAAGITHGMDELYK" misc_feature 952..957 /label=EcoRI/PvuII restriction site /note="EcoRI/PvuII restriction site" promoter 1058..1162 /label=AmpR promoter CDS 1163..2020 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 2194..2782 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2968..3108) /label=bom /note="basis of mobility region from pBR322"
This page is informational only.