Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V006033 | pGFPGUSplus | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pGFPGUSplus
- Antibiotic Resistance:
- Kanamycin
- Length:
- 13701 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Vickers CE, Schenk PM, Li D, Mullineaux PM, Gresshoff PM.
- Promoter:
- CaMV35S(long)
- Growth Strain(s):
- Top10
- Growth Temperature:
- 37℃
pGFPGUSplus vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pGFPGUSplus vector Sequence
LOCUS 40924_21603 13701 bp DNA circular SYN 18-DEC-2018 DEFINITION Binary vector pGFPGUSplus, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 13701) AUTHORS Vickers CE, Schenk PM, Li D, Mullineaux PM, Gresshoff PM. TITLE pGFPGUSPlus, a new binary vector for gene expression studies and optimising transformation systems in plants JOURNAL Biotechnol. Lett. 29 (11), 1793-1796 (2007) PUBMED 17687623 REFERENCE 2 (bases 1 to 13701) AUTHORS Vickers CE, Schenk PM, Mullineaux PM, Gresshoff PM. TITLE Direct Submission JOURNAL Submitted (11-APR-2007) Biological Sciences, The University of Essex, Wivenhoe Park, Colchester, Essex CO43SQ, England REFERENCE 3 (bases 1 to 13701) TITLE Direct Submission REFERENCE 4 (bases 1 to 13701) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Lett."; date: "2007"; volume: "29"; issue: "11"; pages: "1793-1796" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-APR-2007) Biological Sciences, The University of Essex, Wivenhoe Park, Colchester, Essex CO43SQ, England" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..13701 /mol_type="other DNA" /organism="synthetic DNA construct" intron 17..206 /label=cat1 intron /note="castor bean catalase intron, modified" CDS 201..2024 /codon_start=1 /label=GUSPlus(TM) /note="beta-glucuronidase" /translation="LQNRRTSLYPINTETRGVFDLNGVWNFKLDYGKGLEEKWYESKLT DTISMAVPSSYNDIGVTKEIRNHIGYVWYEREFTVPAYLKDQRIVLRFGSATHKAIVYV NGELVVEHKGGFLPFEAEINNSLRDGMNRVTVAVDNILDDSTLPVGLYSERHEEGLGKV IRNKPNFDFFNYAGLHRPVKIYTTPFTYVEDISVVTDFNGPTGTVTYTVDFQGKAETVK VSVVDEEGKVVASTEGLSGNVEIPNVILWEPLNTYLYQIKVELVNDGLTIDVYEEPFGV RTVEVNDGKFLINNKPFYFKGFGKHEDTPINGRGFNEASNVMDFNILKWIGANSFRTAH YPYSEELMRLADREGLVVIDETPAVGVHLNFMATTGLGEGSERVSTWEKIRTFEHHQDV LRELVSRDKNHPSVVMWSIANEAATEEEGAYEYFKPLVELTKELDPQKRPVTIVLFVMA TPETDKVAELIDVIALNRYNGWYFDGGDLEAAKVHLRQEFHAWNKRCPGKPIMITEYGA DTVAGFHDIDPVMFTEEYQVEYYQANHVVFDEFENFVGEQAWNFADFATSQGVMRVQGN KKGVFTRDRKPKLAAHVFRERWTNIPDFGYKN" CDS 2031..2048 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 2080..2332 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" misc_feature 2354..2378 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" CDS 3678..4304 /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI" CDS 4741..5805 /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV MRYRNLIEGEASAGS" rep_origin 5874..6068 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 6412..6552 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(6738..7326) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7416..8207) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" misc_feature 8632..8656 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" polyA_signal complement(8734..8908) /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" CDS complement(8951..9973) /codon_start=1 /label=HygR /note="aminoglycoside phosphotransferase from E. coli" /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK K" promoter complement(10041..10718) /label=CaMV 35S promoter (enhanced) /note="cauliflower mosaic virus 35S promoter with a duplicated enhancer region" protein_bind 10909..10930 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 10945..10975 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 10983..10999 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 11007..11023 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" terminator complement(11041..11293) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(11342..12058) /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTFTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" promoter complement(12088..12433) /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" primer_bind complement(12948..12964) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 13341..13686 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus"