pGEXGSTp65(12-317) vector (V006047)

Download GeneBank File(.gb)

LOCUS       40924_21514        5872 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Bacterial expression vector pGEXGSTp65(12-317), complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5872)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5872)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 5872)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5872)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 
            9052, BELGIUM"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5872
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(274..447)
                     /label=lacZ-alpha
                     /note="LacZ-alpha fragment of beta-galactosidase"
     misc_feature    complement(448..485)
                     /label=5' UTR of lacZ, incl. RBS
                     /note="5' UTR of lacZ, incl. RBS"
     protein_bind    467..483
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(491..521)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(536..557)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     CDS             complement(573..1652)
                     /label=lacI
                     /note="lac repressor"
     promoter        complement(1653..1730)
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     rep_origin      complement(1974..2562)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2736..3593)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(3594..3698)
                     /label=AmpR promoter
     CDS             complement(4020..4937)
                     /codon_start=1
                     /note="unnamed protein product; hNF-kappaB p65 fragment"
                     /protein_id="SJL87357.1"
                     /translation="EPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTK
                     THPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQN
                     LGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLR
                     LPPVLPHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGW
                     EARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDT
                     DDRHRIEEKRKRTYETFKSIMKKSP"
     CDS             complement(4938..4955)
                     /label=thrombin site
                     /note="thrombin recognition and cleavage site"
     CDS             complement(4962..5615)
                     /label=GST
                     /note="glutathione S-transferase from Schistosoma
                     japonicum"
     protein_bind    complement(5638..5654)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(5662..5690)
                     /label=tac promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"