Basic Vector Information
- Vector Name:
- pGEXGSTp65(12-317)
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5872 bp
- Type:
- Bacterial expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pGEXGSTp65(12-317) vector Vector Map
pGEXGSTp65(12-317) vector Sequence
LOCUS 40924_21514 5872 bp DNA circular SYN 18-DEC-2018 DEFINITION Bacterial expression vector pGEXGSTp65(12-317), complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5872) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 5872) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 5872) TITLE Direct Submission REFERENCE 4 (bases 1 to 5872) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5872 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(274..447) /label=lacZ-alpha /note="LacZ-alpha fragment of beta-galactosidase" misc_feature complement(448..485) /label=5' UTR of lacZ, incl. RBS /note="5' UTR of lacZ, incl. RBS" protein_bind 467..483 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(491..521) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(536..557) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(573..1652) /label=lacI /note="lac repressor" promoter complement(1653..1730) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." rep_origin complement(1974..2562) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2736..3593) /label=AmpR /note="beta-lactamase" promoter complement(3594..3698) /label=AmpR promoter CDS complement(4020..4937) /codon_start=1 /note="unnamed protein product; hNF-kappaB p65 fragment" /protein_id="SJL87357.1" /translation="EPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTK THPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQN LGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLR LPPVLPHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGW EARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDT DDRHRIEEKRKRTYETFKSIMKKSP" CDS complement(4938..4955) /label=thrombin site /note="thrombin recognition and cleavage site" CDS complement(4962..5615) /label=GST /note="glutathione S-transferase from Schistosoma japonicum" protein_bind complement(5638..5654) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(5662..5690) /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters"
This page is informational only.